From 61e736cbae980433d5b4e547a7d2f159063bced0 Mon Sep 17 00:00:00 2001 From: Jiangli Zhou Date: Mon, 27 Nov 2017 20:21:34 -0800 Subject: [PATCH] 8188791: Move AppCDS from closed repo to open repo Co-authored-by: Mikhailo Seledtsov Co-authored-by: Calvin Cheung Reviewed-by: dsamersoff, simonis, minqi --- .../share/classfile/classListParser.cpp | 408 +- .../share/classfile/classListParser.hpp | 106 +- .../share/classfile/classLoaderExt.cpp | 327 +- .../share/classfile/classLoaderExt.hpp | 147 +- .../share/classfile/sharedClassUtil.cpp | 248 + .../share/classfile/sharedClassUtil.hpp | 111 +- .../share/classfile/systemDictionary.cpp | 2 +- .../classfile/systemDictionaryShared.cpp | 1086 ++ .../classfile/systemDictionaryShared.hpp | 379 +- .../share/classfile/systemDictionary_ext.hpp | 13 +- src/hotspot/share/classfile/vmSymbols.hpp | 9 +- src/hotspot/share/prims/cdsoffsets.cpp | 69 + src/hotspot/share/prims/cdsoffsets.hpp | 48 + src/hotspot/share/prims/whitebox.cpp | 18 + src/hotspot/share/runtime/arguments.cpp | 8 + src/hotspot/share/runtime/arguments_ext.hpp | 1 - src/hotspot/share/runtime/globals.hpp | 7 + test/hotspot/jtreg/TEST.groups | 17 +- .../jtreg/runtime/appcds/AppCDSOptions.java | 45 + .../jtreg/runtime/appcds/AppendClasspath.java | 87 + .../runtime/appcds/BootClassPathMismatch.java | 108 + .../appcds/CaseSensitiveClassPath.java | 92 + .../jtreg/runtime/appcds/ClassLoaderTest.java | 93 + .../jtreg/runtime/appcds/ClassPathAttr.java | 106 + .../runtime/appcds/CommandLineFlagCombo.java | 128 + .../appcds/CommandLineFlagComboNegative.java | 101 + .../jtreg/runtime/appcds/CompilerUtils.java | 80 + .../jtreg/runtime/appcds/DumpClassList.java | 103 + .../runtime/appcds/ExtraSymbols.invalid_1.txt | 11 + .../runtime/appcds/ExtraSymbols.invalid_2.txt | 5 + .../runtime/appcds/ExtraSymbols.invalid_3.txt | 13 + .../jtreg/runtime/appcds/ExtraSymbols.java | 89 + .../runtime/appcds/ExtraSymbols.symbols.txt | 10826 ++++++++++++++++ .../runtime/appcds/FieldAnnotationsTest.java | 67 + .../runtime/appcds/FreeUnusedMetadata.java | 118 + .../jtreg/runtime/appcds/HelloExtTest.java | 72 + .../jtreg/runtime/appcds/HelloTest.java | 44 + .../runtime/appcds/IgnoreEmptyClassPaths.java | 63 + .../jtreg/runtime/appcds/JarBuilder.java | 235 + .../jtreg/runtime/appcds/JvmtiAddPath.java | 107 + .../runtime/appcds/MismatchedUseAppCDS.java | 81 + .../runtime/appcds/MissingSuperTest.java | 52 + .../runtime/appcds/MultiProcessSharing.java | 144 + .../runtime/appcds/MultiReleaseJars.java | 238 + .../jtreg/runtime/appcds/OldClassTest.java | 167 + .../jtreg/runtime/appcds/PackageSealing.java | 60 + .../jtreg/runtime/appcds/ParallelLoad2.java | 64 + .../runtime/appcds/ParallelLoadTest.java | 64 + .../appcds/PrintSharedArchiveAndExit.java | 148 + .../runtime/appcds/ProhibitedPackage.java | 101 + .../runtime/appcds/ProtectionDomain.java | 73 + .../runtime/appcds/RewriteBytecodesTest.java | 65 + .../appcds/SharedArchiveConsistency.java | 386 + .../runtime/appcds/SharedArchiveFile.java | 83 + .../runtime/appcds/SharedBaseAddress.java | 65 + .../jtreg/runtime/appcds/SharedPackages.java | 79 + .../jtreg/runtime/appcds/SignedJar.java | 69 + .../runtime/appcds/SpecifySysLoaderProp.java | 107 + .../jtreg/runtime/appcds/TestCommon.java | 339 + .../runtime/appcds/TraceLongClasspath.java | 105 + .../jtreg/runtime/appcds/UseAppCDS.java | 228 + .../jtreg/runtime/appcds/UseAppCDS_Test.java | 30 + .../jtreg/runtime/appcds/VerifierTest.java | 343 + .../jtreg/runtime/appcds/VerifierTest_0.java | 38 + .../jtreg/runtime/appcds/VerifierTest_1A.java | 38 + .../jtreg/runtime/appcds/VerifierTest_1B.java | 38 + .../jtreg/runtime/appcds/VerifierTest_2.java | 38 + .../jtreg/runtime/appcds/WideIloadTest.java | 50 + .../jtreg/runtime/appcds/WrongClasspath.java | 56 + .../appcds/XShareAutoWithChangedJar.java | 55 + .../CheckCachedResolvedReferences.java | 69 + .../CheckCachedResolvedReferencesApp.java | 77 + .../DumpTimeVerifyFailure.config.txt | 3 + .../cacheObject/DumpTimeVerifyFailure.java | 63 + .../appcds/cacheObject/GCStress.config.txt | 3 + .../appcds/cacheObject/GCStressApp.java | 93 + .../appcds/cacheObject/GCStressTest.java | 61 + .../cacheObject/InstrumentationAgent.mf | 5 + .../appcds/cacheObject/MyException.java | 15 +- .../runtime/appcds/cacheObject/MyOuter.java | 43 + .../appcds/cacheObject/OpenArchiveRegion.java | 63 + .../cacheObject/RangeNotWithinHeap.java | 72 + .../appcds/cacheObject/RedefineClassApp.java | 149 + .../appcds/cacheObject/RedefineClassTest.java | 105 + .../appcds/customLoader/ClassListFormatA.java | 138 + .../appcds/customLoader/ClassListFormatB.java | 74 + .../customLoader/ClassListFormatBase.java | 82 + .../appcds/customLoader/ClassListFormatC.java | 76 + .../appcds/customLoader/ClassListFormatD.java | 85 + .../appcds/customLoader/ClassListFormatE.java | 111 + .../appcds/customLoader/CustomLoaderApp.java | 110 + .../appcds/customLoader/HelloCustom.java | 75 + .../customLoader/LoaderSegregationTest.java | 125 + .../appcds/customLoader/ParallelTestBase.java | 99 + .../customLoader/ParallelTestMultiFP.java | 44 + .../customLoader/ParallelTestSingleFP.java | 44 + .../ProhibitedPackageNamesTest.java | 60 + .../appcds/customLoader/ProtectionDomain.java | 61 + .../SameNameInTwoLoadersTest.java | 94 + .../customLoader/UnintendedLoadersTest.java | 76 + .../UnloadUnregisteredLoaderTest.java | 82 + .../customLoader/UnsupportedPlatforms.java | 67 + .../test-classes/CustomInterface2_ia.java | 25 + .../test-classes/CustomInterface2_ib.java | 25 + .../test-classes/CustomLoadee.java | 29 + .../test-classes/CustomLoadee2.java | 29 + .../test-classes/CustomLoadee3.java | 29 + .../test-classes/CustomLoadee3Child.java | 29 + .../customLoader/test-classes/Hello.java | 56 + .../test-classes/InProhibitedPkg.java | 33 + .../customLoader/test-classes/LoaderAPI.mf | 12 + .../test-classes/LoaderSegregation.java | 99 + .../test-classes/OnlyBuiltin.java | 28 + .../test-classes/OnlyUnregistered.java | 28 + .../customLoader/test-classes/ProtDomain.java | 55 + .../SameNameUnrelatedLoaders.java | 101 + .../test-classes/SimpleHello.java | 29 + .../test-classes/UnintendedLoaders.java | 54 + .../UnloadUnregisteredLoader.java | 69 + .../runtime/appcds/javaldr/ArrayTest.java | 78 + .../appcds/javaldr/ArrayTestHelper.java | 46 + .../appcds/javaldr/CheckAnonymousClass.java | 75 + .../runtime/appcds/javaldr/GCDuringDump.java | 80 + .../javaldr/GCDuringDumpTransformer.java | 72 + .../appcds/javaldr/GCDuringDumpTransformer.mf | 5 + .../javaldr/GCSharedStringsDuringDump.java | 131 + .../javaldr/GCSharedStringsDuringDumpWb.java | 45 + .../CheckUnsupportedDumpingOptions.java | 102 + .../appcds/jigsaw/JigsawOptionsCombo.java | 216 + .../jigsaw/PatchModule/AppClassInCP.java | 104 + .../jigsaw/PatchModule/CustomPackage.java | 83 + .../PatchModule/MismatchedPatchModule.java | 132 + .../appcds/jigsaw/PatchModule/PatchDir.java | 73 + .../jigsaw/PatchModule/PatchJavaBase.java | 73 + .../appcds/jigsaw/PatchModule/PatchMain.java | 33 + .../appcds/jigsaw/PatchModule/Simple.java | 81 + .../PatchModule/SubClassOfPatchedClass.java | 105 + .../appcds/jigsaw/PatchModule/TwoJars.java | 100 + .../classpathtests/BootAppendTests.java | 256 + .../jigsaw/classpathtests/ClassPathTests.java | 240 + .../DummyClassesInBootClassPath.java | 88 + .../EmptyClassInBootClassPath.java | 106 + .../src/com/sun/tools/javac/Main.jasm | 46 + .../src/com/sun/tools/javac/Main2.jasm | 46 + .../UnsupportedDataTypeException2.jasm | 46 + .../classpathtests/src/jdk/test/Main.java | 122 + .../src/sun/nio/cs/ext/MyClass.java | 31 + .../src/sun/nio/cs/ext1/MyClass.java | 31 + .../jigsaw/limitmods/LimitModsHelper.java | 93 + .../jigsaw/limitmods/LimitModsTests.java | 164 + .../jigsaw/overridetests/OverrideTests.java | 238 + .../UnsupportedDataTypeException.java | 36 + .../src/java.activation/module-info.java | 28 + .../com/sun/tools/javac/Main.java | 31 + .../src/jdk.compiler/module-info.java | 28 + .../overridetests/src/test/jdk/test/Main.java | 101 + .../overridetests/src/test/module-info.java | 28 + .../appcds/jvmti/ClassFileLoadHook.java | 93 + .../appcds/jvmti/ClassFileLoadHookTest.java | 100 + .../appcds/jvmti/InstrumentationAgent.mf | 5 + .../appcds/jvmti/InstrumentationApp.java | 220 + .../InstrumentationClassFileTransformer.java | 57 + ...mentationRegisterClassFileTransformer.java | 45 + .../appcds/jvmti/InstrumentationTest.java | 278 + .../ParallelClassesTransform.java | 70 + .../ParallelLoadAndTransformTest.java | 88 + .../TransformInterfaceImplementorAppCDS.java | 43 + .../TransformRelatedClassesAppCDS.java | 204 + .../TransformSuperSubAppCDS.java | 43 + .../appcds/redefineClass/RedefineBasic.java | 105 + .../redefineClass/RedefineBasicTest.java | 76 + .../RedefineRunningMethods_Shared.java | 82 + .../RedefineRunningMethods_SharedHelper.java | 49 + .../appcds/sharedStrings/ExerciseGC.java | 49 + .../appcds/sharedStrings/ExtraSharedInput.txt | 7 + .../appcds/sharedStrings/FlagCombo.java | 58 + .../appcds/sharedStrings/HelloString.java | 32 + .../appcds/sharedStrings/HelloStringGC.java | 69 + .../appcds/sharedStrings/HelloStringPlus.java | 76 + .../sharedStrings/IncompatibleOptions.java | 145 + .../sharedStrings/InternSharedString.java | 56 + .../sharedStrings/InternStringTest.java | 79 + .../sharedStrings/InvalidFileFormat.java | 73 + .../appcds/sharedStrings/LargePages.java | 53 + .../sharedStrings/LockSharedStrings.java | 57 + .../appcds/sharedStrings/LockStringTest.java | 68 + .../sharedStrings/LockStringValueTest.java | 61 + .../sharedStrings/SharedStringsBasic.java | 78 + .../sharedStrings/SharedStringsBasic.txt | 60 + .../sharedStrings/SharedStringsBasicPlus.java | 50 + .../sharedStrings/SharedStringsStress.java | 71 + .../sharedStrings/SharedStringsUtils.java | 143 + .../appcds/sharedStrings/SharedStringsWb.java | 40 + .../sharedStrings/SharedStringsWbTest.java | 53 + .../appcds/sharedStrings/SysDictCrash.java | 63 + .../invalidFormat/CorruptDataLine.txt | 60 + .../invalidFormat/InvalidDataType.txt | 60 + .../invalidFormat/InvalidHeader.txt | 60 + .../invalidFormat/InvalidString.txt | 6 + .../invalidFormat/InvalidStringFormat.txt | 60 + .../invalidFormat/InvalidSymbol.txt | 12 + .../invalidFormat/InvalidSymbolFormat.txt | 11 + .../invalidFormat/InvalidVersion.txt | 60 + .../invalidFormat/OverflowPrefix.txt | 11 + .../invalidFormat/TruncatedString.txt | 10 + .../invalidFormat/UnrecognizedPrefix.txt | 11 + .../appcds/test-classes/ArrayListTest.java | 41 + .../BootClassPathAppendHelper.java | 42 + .../jtreg/runtime/appcds/test-classes/C1.java | 28 + .../jtreg/runtime/appcds/test-classes/C2.java | 28 + .../appcds/test-classes/CheckIfShared.java | 40 + .../runtime/appcds/test-classes/Child.java | 25 + .../runtime/appcds/test-classes/CpAttr1.java | 38 + .../runtime/appcds/test-classes/CpAttr2.java | 25 + .../runtime/appcds/test-classes/CpAttr3.java | 26 + .../runtime/appcds/test-classes/CpAttr4.java | 28 + .../runtime/appcds/test-classes/CpAttr5.java | 25 + .../appcds/test-classes/DummyClassHelper.java | 58 + .../appcds/test-classes/EmptyClassHelper.java | 59 + .../test-classes/FieldAnnotationsApp.java | 58 + .../appcds/test-classes/ForNameTest.java | 45 + .../runtime/appcds/test-classes/Greet.java | 30 + .../runtime/appcds/test-classes/Hello.java | 29 + .../runtime/appcds/test-classes/HelloExt.java | 59 + .../appcds/test-classes/HelloExtApp.java | 29 + .../appcds/test-classes/HelloExtExt.java | 27 + .../appcds/test-classes/HelloMore.java | 30 + .../runtime/appcds/test-classes/HelloWB.java | 37 + .../jtreg/runtime/appcds/test-classes/Hi.java | 35 + .../runtime/appcds/test-classes/Iloadw.jasm | 37 + .../appcds/test-classes/IloadwMain.java | 35 + .../test-classes/JimageClassPackage.java | 95 + .../test-classes/JimageClassProtDomain.java | 74 + .../runtime/appcds/test-classes/JvmtiApp.java | 105 + .../appcds/test-classes/MethodNoReturn.jasm | 93 + .../appcds/test-classes/MissingSuper.java | 49 + .../appcds/test-classes/MultiProcClass.java | 66 + .../appcds/test-classes/MyAnnotation.java | 36 + .../test-classes/PackageSealingTest.java | 52 + .../appcds/test-classes/PackageTest.java | 56 + .../appcds/test-classes/ParallelClasses.java | 64 + .../appcds/test-classes/ParallelLoad.java | 220 + .../appcds/test-classes/Prohibited.jasm | 30 + .../appcds/test-classes/ProhibitedHelper.java | 57 + .../appcds/test-classes/ProtDomain.java | 53 + .../appcds/test-classes/ProtDomainB.java | 53 + .../appcds/test-classes/ReportMyLoader.java | 31 + .../appcds/test-classes/RewriteBytecodes.java | 55 + .../runtime/appcds/test-classes/Super.java | 29 + .../appcds/test-classes/TestClassLoader.java | 42 + .../test-classes/TrySwitchMyLoader.java | 36 + .../runtime/appcds/test-classes/Util.java | 156 + .../appcds/test-classes/VerifierTest0.java | 75 + .../com/sun/tools/javac/Main.jasm | 30 + .../runtime/appcds/test-classes/cpattr1.mf | 3 + .../appcds/test-classes/cpattr1_long.mf | 18 + .../runtime/appcds/test-classes/cpattr2.mf | 4 + .../runtime/appcds/test-classes/cpattr3.mf | 2 + .../runtime/appcds/test-classes/cpattr4.mf | 2 + .../appcds/test-classes/cpattr5_extra_long.mf | 3 + .../test-classes/java/net/HttpCookie.jasm | 37 + .../javax/activation/MimeType.jasm | 37 + .../InvalidTransactionException.jasm | 37 + .../jdk/dynalink/DynamicLinker.jasm | 37 + .../appcds/test-classes/package_seal.mf | 6 + 265 files changed, 31331 insertions(+), 134 deletions(-) create mode 100644 src/hotspot/share/classfile/sharedClassUtil.cpp create mode 100644 src/hotspot/share/classfile/systemDictionaryShared.cpp create mode 100644 src/hotspot/share/prims/cdsoffsets.cpp create mode 100644 src/hotspot/share/prims/cdsoffsets.hpp create mode 100644 test/hotspot/jtreg/runtime/appcds/AppCDSOptions.java create mode 100644 test/hotspot/jtreg/runtime/appcds/AppendClasspath.java create mode 100644 test/hotspot/jtreg/runtime/appcds/BootClassPathMismatch.java create mode 100644 test/hotspot/jtreg/runtime/appcds/CaseSensitiveClassPath.java create mode 100644 test/hotspot/jtreg/runtime/appcds/ClassLoaderTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/ClassPathAttr.java create mode 100644 test/hotspot/jtreg/runtime/appcds/CommandLineFlagCombo.java create mode 100644 test/hotspot/jtreg/runtime/appcds/CommandLineFlagComboNegative.java create mode 100644 test/hotspot/jtreg/runtime/appcds/CompilerUtils.java create mode 100644 test/hotspot/jtreg/runtime/appcds/DumpClassList.java create mode 100644 test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_1.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_2.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_3.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/ExtraSymbols.java create mode 100644 test/hotspot/jtreg/runtime/appcds/ExtraSymbols.symbols.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/FieldAnnotationsTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/FreeUnusedMetadata.java create mode 100644 test/hotspot/jtreg/runtime/appcds/HelloExtTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/HelloTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/IgnoreEmptyClassPaths.java create mode 100644 test/hotspot/jtreg/runtime/appcds/JarBuilder.java create mode 100644 test/hotspot/jtreg/runtime/appcds/JvmtiAddPath.java create mode 100644 test/hotspot/jtreg/runtime/appcds/MismatchedUseAppCDS.java create mode 100644 test/hotspot/jtreg/runtime/appcds/MissingSuperTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/MultiProcessSharing.java create mode 100644 test/hotspot/jtreg/runtime/appcds/MultiReleaseJars.java create mode 100644 test/hotspot/jtreg/runtime/appcds/OldClassTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/PackageSealing.java create mode 100644 test/hotspot/jtreg/runtime/appcds/ParallelLoad2.java create mode 100644 test/hotspot/jtreg/runtime/appcds/ParallelLoadTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/PrintSharedArchiveAndExit.java create mode 100644 test/hotspot/jtreg/runtime/appcds/ProhibitedPackage.java create mode 100644 test/hotspot/jtreg/runtime/appcds/ProtectionDomain.java create mode 100644 test/hotspot/jtreg/runtime/appcds/RewriteBytecodesTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/SharedArchiveConsistency.java create mode 100644 test/hotspot/jtreg/runtime/appcds/SharedArchiveFile.java create mode 100644 test/hotspot/jtreg/runtime/appcds/SharedBaseAddress.java create mode 100644 test/hotspot/jtreg/runtime/appcds/SharedPackages.java create mode 100644 test/hotspot/jtreg/runtime/appcds/SignedJar.java create mode 100644 test/hotspot/jtreg/runtime/appcds/SpecifySysLoaderProp.java create mode 100644 test/hotspot/jtreg/runtime/appcds/TestCommon.java create mode 100644 test/hotspot/jtreg/runtime/appcds/TraceLongClasspath.java create mode 100644 test/hotspot/jtreg/runtime/appcds/UseAppCDS.java create mode 100644 test/hotspot/jtreg/runtime/appcds/UseAppCDS_Test.java create mode 100644 test/hotspot/jtreg/runtime/appcds/VerifierTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/VerifierTest_0.java create mode 100644 test/hotspot/jtreg/runtime/appcds/VerifierTest_1A.java create mode 100644 test/hotspot/jtreg/runtime/appcds/VerifierTest_1B.java create mode 100644 test/hotspot/jtreg/runtime/appcds/VerifierTest_2.java create mode 100644 test/hotspot/jtreg/runtime/appcds/WideIloadTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/WrongClasspath.java create mode 100644 test/hotspot/jtreg/runtime/appcds/XShareAutoWithChangedJar.java create mode 100644 test/hotspot/jtreg/runtime/appcds/cacheObject/CheckCachedResolvedReferences.java create mode 100644 test/hotspot/jtreg/runtime/appcds/cacheObject/CheckCachedResolvedReferencesApp.java create mode 100644 test/hotspot/jtreg/runtime/appcds/cacheObject/DumpTimeVerifyFailure.config.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/cacheObject/DumpTimeVerifyFailure.java create mode 100644 test/hotspot/jtreg/runtime/appcds/cacheObject/GCStress.config.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/cacheObject/GCStressApp.java create mode 100644 test/hotspot/jtreg/runtime/appcds/cacheObject/GCStressTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/cacheObject/InstrumentationAgent.mf rename src/hotspot/share/classfile/vmSymbols_ext.hpp => test/hotspot/jtreg/runtime/appcds/cacheObject/MyException.java (79%) create mode 100644 test/hotspot/jtreg/runtime/appcds/cacheObject/MyOuter.java create mode 100644 test/hotspot/jtreg/runtime/appcds/cacheObject/OpenArchiveRegion.java create mode 100644 test/hotspot/jtreg/runtime/appcds/cacheObject/RangeNotWithinHeap.java create mode 100644 test/hotspot/jtreg/runtime/appcds/cacheObject/RedefineClassApp.java create mode 100644 test/hotspot/jtreg/runtime/appcds/cacheObject/RedefineClassTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatA.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatB.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatBase.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatC.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatD.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatE.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/CustomLoaderApp.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/HelloCustom.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/LoaderSegregationTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/ParallelTestBase.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/ParallelTestMultiFP.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/ParallelTestSingleFP.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/ProhibitedPackageNamesTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/ProtectionDomain.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/SameNameInTwoLoadersTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/UnintendedLoadersTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/UnloadUnregisteredLoaderTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/UnsupportedPlatforms.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/CustomInterface2_ia.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/CustomInterface2_ib.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/CustomLoadee.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/CustomLoadee2.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/CustomLoadee3.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/CustomLoadee3Child.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/Hello.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/InProhibitedPkg.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/LoaderAPI.mf create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/LoaderSegregation.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/OnlyBuiltin.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/OnlyUnregistered.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/ProtDomain.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/SameNameUnrelatedLoaders.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/SimpleHello.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/UnintendedLoaders.java create mode 100644 test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/UnloadUnregisteredLoader.java create mode 100644 test/hotspot/jtreg/runtime/appcds/javaldr/ArrayTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/javaldr/ArrayTestHelper.java create mode 100644 test/hotspot/jtreg/runtime/appcds/javaldr/CheckAnonymousClass.java create mode 100644 test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDump.java create mode 100644 test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDumpTransformer.java create mode 100644 test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDumpTransformer.mf create mode 100644 test/hotspot/jtreg/runtime/appcds/javaldr/GCSharedStringsDuringDump.java create mode 100644 test/hotspot/jtreg/runtime/appcds/javaldr/GCSharedStringsDuringDumpWb.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/CheckUnsupportedDumpingOptions.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/JigsawOptionsCombo.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/AppClassInCP.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/CustomPackage.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/MismatchedPatchModule.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchDir.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchJavaBase.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchMain.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/Simple.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/SubClassOfPatchedClass.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/TwoJars.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/BootAppendTests.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/ClassPathTests.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/DummyClassesInBootClassPath.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/EmptyClassInBootClassPath.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/com/sun/tools/javac/Main.jasm create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/com/sun/tools/javac/Main2.jasm create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/javax/activation/UnsupportedDataTypeException2.jasm create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/jdk/test/Main.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/sun/nio/cs/ext/MyClass.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/sun/nio/cs/ext1/MyClass.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/limitmods/LimitModsHelper.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/limitmods/LimitModsTests.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/OverrideTests.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/java.activation/javax/activation/UnsupportedDataTypeException.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/java.activation/module-info.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/jdk.compiler/com/sun/tools/javac/Main.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/jdk.compiler/module-info.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/test/jdk/test/Main.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/test/module-info.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jvmti/ClassFileLoadHook.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jvmti/ClassFileLoadHookTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationAgent.mf create mode 100644 test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationApp.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationClassFileTransformer.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationRegisterClassFileTransformer.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jvmti/parallelLoad/ParallelClassesTransform.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jvmti/parallelLoad/ParallelLoadAndTransformTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformInterfaceImplementorAppCDS.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformRelatedClassesAppCDS.java create mode 100644 test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformSuperSubAppCDS.java create mode 100644 test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineBasic.java create mode 100644 test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineBasicTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineRunningMethods_Shared.java create mode 100644 test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineRunningMethods_SharedHelper.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/ExerciseGC.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/ExtraSharedInput.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/FlagCombo.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloString.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloStringGC.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloStringPlus.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/IncompatibleOptions.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/InternSharedString.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/InternStringTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/InvalidFileFormat.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/LargePages.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/LockSharedStrings.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/LockStringTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/LockStringValueTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasic.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasic.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasicPlus.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsStress.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsUtils.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsWb.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsWbTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/SysDictCrash.java create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/CorruptDataLine.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidDataType.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidHeader.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidString.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidStringFormat.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidSymbol.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidSymbolFormat.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidVersion.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/OverflowPrefix.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/TruncatedString.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/UnrecognizedPrefix.txt create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/ArrayListTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/BootClassPathAppendHelper.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/C1.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/C2.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/CheckIfShared.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/Child.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr1.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr2.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr3.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr4.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr5.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/DummyClassHelper.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/EmptyClassHelper.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/FieldAnnotationsApp.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/ForNameTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/Greet.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/Hello.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/HelloExt.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/HelloExtApp.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/HelloExtExt.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/HelloMore.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/HelloWB.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/Hi.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/Iloadw.jasm create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/IloadwMain.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/JimageClassPackage.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/JimageClassProtDomain.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/JvmtiApp.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/MethodNoReturn.jasm create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/MissingSuper.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/MultiProcClass.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/MyAnnotation.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/PackageSealingTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/PackageTest.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/ParallelClasses.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/ParallelLoad.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/Prohibited.jasm create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/ProhibitedHelper.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/ProtDomain.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/ProtDomainB.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/ReportMyLoader.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/RewriteBytecodes.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/Super.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/TestClassLoader.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/TrySwitchMyLoader.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/Util.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/VerifierTest0.java create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/com/sun/tools/javac/Main.jasm create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/cpattr1.mf create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/cpattr1_long.mf create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/cpattr2.mf create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/cpattr3.mf create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/cpattr4.mf create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/cpattr5_extra_long.mf create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/java/net/HttpCookie.jasm create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/javax/activation/MimeType.jasm create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/javax/transaction/InvalidTransactionException.jasm create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/jdk/dynalink/DynamicLinker.jasm create mode 100644 test/hotspot/jtreg/runtime/appcds/test-classes/package_seal.mf diff --git a/src/hotspot/share/classfile/classListParser.cpp b/src/hotspot/share/classfile/classListParser.cpp index 8f7be316b50..ed7fa514dcc 100644 --- a/src/hotspot/share/classfile/classListParser.cpp +++ b/src/hotspot/share/classfile/classListParser.cpp @@ -1,5 +1,5 @@ /* - * Copyright (c) 2015, Oracle and/or its affiliates. All rights reserved. + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. * * This code is free software; you can redistribute it and/or modify it @@ -23,13 +23,32 @@ */ #include "precompiled.hpp" +#include "jvm.h" +#include "jimage.hpp" #include "classfile/classListParser.hpp" -#include "runtime/os.hpp" -#include "runtime/java.hpp" +#include "classfile/classLoaderExt.hpp" +#include "classfile/sharedClassUtil.hpp" +#include "classfile/symbolTable.hpp" +#include "classfile/systemDictionary.hpp" +#include "classfile/systemDictionaryShared.hpp" +#include "memory/metaspaceShared.hpp" +#include "memory/resourceArea.hpp" +#include "runtime/fieldType.hpp" +#include "runtime/javaCalls.hpp" +#include "utilities/defaultStream.hpp" +#include "utilities/hashtable.inline.hpp" +#include "utilities/macros.hpp" + +ClassListParser* ClassListParser::_instance = NULL; ClassListParser::ClassListParser(const char* file) { + assert(_instance == NULL, "must be singleton"); + _instance = this; _classlist_file = file; _file = fopen(file, "r"); + _line_no = 0; + _interfaces = new (ResourceObj::C_HEAP, mtClass) GrowableArray(10, true); + if (_file == NULL) { char errmsg[JVM_MAXPATHLEN]; os::lasterror(errmsg, JVM_MAXPATHLEN); @@ -41,6 +60,7 @@ ClassListParser::~ClassListParser() { if (_file) { fclose(_file); } + _instance = NULL; } bool ClassListParser::parse_one_line() { @@ -48,10 +68,10 @@ bool ClassListParser::parse_one_line() { if (fgets(_line, sizeof(_line), _file) == NULL) { return false; } - int line_len = (int)strlen(_line); - if (line_len > _max_allowed_line_len) { - tty->print_cr("input line too long (must be no longer than %d chars)", _max_allowed_line_len); - vm_exit_during_initialization("Loading classlist failed"); + ++ _line_no; + _line_len = (int)strlen(_line); + if (_line_len > _max_allowed_line_len) { + error("input line too long (must be no longer than %d chars)", _max_allowed_line_len); } if (*_line == '#') { // comment continue; @@ -59,8 +79,378 @@ bool ClassListParser::parse_one_line() { break; } - // Remove trailing \r\n - _line[strcspn(_line, "\r\n")] = 0; + _id = _unspecified; + _super = _unspecified; + _interfaces->clear(); + _source = NULL; + _interfaces_specified = false; + + { + int len = (int)strlen(_line); + int i; + // Replace \t\r\n with ' ' + for (i=0; i 0) { + if (_line[len-1] == ' ') { + _line[len-1] = '\0'; + len --; + } else { + break; + } + } + _line_len = len; + _class_name = _line; + } + + if ((_token = strchr(_line, ' ')) == NULL) { + // No optional arguments are specified. + return true; + } + + // Mark the end of the name, and go to the next input char + *_token++ = '\0'; + + while (*_token) { + skip_whitespaces(); + + if (parse_int_option("id:", &_id)) { + continue; + } else if (parse_int_option("super:", &_super)) { + check_already_loaded("Super class", _super); + continue; + } else if (skip_token("interfaces:")) { + int i; + while (try_parse_int(&i)) { + check_already_loaded("Interface", i); + _interfaces->append(i); + } + } else if (skip_token("source:")) { + skip_whitespaces(); + _source = _token; + char* s = strchr(_token, ' '); + if (s == NULL) { + break; // end of input line + } else { + *s = '\0'; // mark the end of _source + _token = s+1; + } + } else { + error("Unknown input"); + } + } + + // if src is specified + // id super interfaces must all be specified + // loader may be specified + // else + // # the class is loaded from classpath + // id may be specified + // super, interfaces, loader must not be specified return true; } +void ClassListParser::skip_whitespaces() { + while (*_token == ' ' || *_token == '\t') { + _token ++; + } +} + +void ClassListParser::skip_non_whitespaces() { + while (*_token && *_token != ' ' && *_token != '\t') { + _token ++; + } +} + +void ClassListParser::parse_int(int* value) { + skip_whitespaces(); + if (sscanf(_token, "%i", value) == 1) { + skip_non_whitespaces(); + if (*value < 0) { + error("Error: negative integers not allowed (%d)", *value); + } + } else { + error("Error: expected integer"); + } +} + +bool ClassListParser::try_parse_int(int* value) { + skip_whitespaces(); + if (sscanf(_token, "%i", value) == 1) { + skip_non_whitespaces(); + return true; + } + return false; +} + +bool ClassListParser::skip_token(const char* option_name) { + size_t len = strlen(option_name); + if (strncmp(_token, option_name, len) == 0) { + _token += len; + return true; + } else { + return false; + } +} + +bool ClassListParser::parse_int_option(const char* option_name, int* value) { + if (skip_token(option_name)) { + if (*value != _unspecified) { + error("%s specified twice", option_name); + } else { + parse_int(value); + return true; + } + } + return false; +} + +void ClassListParser::print_specified_interfaces() { + const int n = _interfaces->length(); + jio_fprintf(defaultStream::error_stream(), "Currently specified interfaces[%d] = {\n", n); + for (int i=0; iat(i)); + jio_fprintf(defaultStream::error_stream(), " %4d = %s\n", _interfaces->at(i), k->name()->as_klass_external_name()); + } + jio_fprintf(defaultStream::error_stream(), "}\n"); +} + +void ClassListParser::print_actual_interfaces(InstanceKlass *ik) { + int n = ik->local_interfaces()->length(); + jio_fprintf(defaultStream::error_stream(), "Actual interfaces[%d] = {\n", n); + for (int i = 0; i < n; i++) { + InstanceKlass* e = InstanceKlass::cast(ik->local_interfaces()->at(i)); + jio_fprintf(defaultStream::error_stream(), " %s\n", e->name()->as_klass_external_name()); + } + jio_fprintf(defaultStream::error_stream(), "}\n"); +} + +void ClassListParser::error(const char *msg, ...) { + va_list ap; + va_start(ap, msg); + int error_index = _token - _line; + if (error_index >= _line_len) { + error_index = _line_len - 1; + } + if (error_index < 0) { + error_index = 0; + } + + jio_fprintf(defaultStream::error_stream(), + "An error has occurred while processing class list file %s %d:%d.\n", + _classlist_file, _line_no, (error_index + 1)); + jio_vfprintf(defaultStream::error_stream(), msg, ap); + + if (_line_len <= 0) { + jio_fprintf(defaultStream::error_stream(), "\n"); + } else { + jio_fprintf(defaultStream::error_stream(), ":\n"); + for (int i=0; i<_line_len; i++) { + char c = _line[i]; + if (c == '\0') { + jio_fprintf(defaultStream::error_stream(), "%s", " "); + } else { + jio_fprintf(defaultStream::error_stream(), "%c", c); + } + } + jio_fprintf(defaultStream::error_stream(), "\n"); + for (int i=0; ilocal_interfaces()->length() != _interfaces->length()) { + print_specified_interfaces(); + print_actual_interfaces(k); + error("The number of interfaces (%d) specified in class list does not match the class file (%d)", + _interfaces->length(), k->local_interfaces()->length()); + } + + if (!SystemDictionaryShared::add_non_builtin_klass(class_name, ClassLoaderData::the_null_class_loader_data(), + k, THREAD)) { + error("Duplicated class %s", _class_name); + } + + // This tells JVM_FindLoadedClass to not find this class. + k->set_shared_classpath_index(UNREGISTERED_INDEX); + } + + return k; +} + +InstanceKlass* ClassListParser::load_current_class(TRAPS) { + TempNewSymbol class_name_symbol = SymbolTable::new_symbol(_class_name, THREAD); + guarantee(!HAS_PENDING_EXCEPTION, "Exception creating a symbol."); + + InstanceKlass *klass = NULL; + if (!is_loading_from_source()) { + if (is_super_specified()) { + error("If source location is not specified, super class must not be specified"); + } + if (are_interfaces_specified()) { + error("If source location is not specified, interface(s) must not be specified"); + } + + bool non_array = !FieldType::is_array(class_name_symbol); + + Handle s = java_lang_String::create_from_symbol(class_name_symbol, CHECK_0); + // Translate to external class name format, i.e., convert '/' chars to '.' + Handle string = java_lang_String::externalize_classname(s, CHECK_0); + JavaValue result(T_OBJECT); + InstanceKlass* spec_klass = non_array ? + SystemDictionary::ClassLoader_klass() : SystemDictionary::Class_klass(); + Symbol* method_name = non_array ? + vmSymbols::loadClass_name() : vmSymbols::forName_name(); + Handle loader = Handle(THREAD, SystemDictionary::java_system_loader()); + + if (non_array) { + JavaCalls::call_virtual(&result, + loader, //SystemDictionary::java_system_loader(), + spec_klass, + method_name, //vmSymbols::loadClass_name(), + vmSymbols::string_class_signature(), + string, + THREAD); + } else { + JavaCalls::call_static(&result, + spec_klass, + method_name, + vmSymbols::string_class_signature(), + string, + CHECK_NULL); + } + assert(result.get_type() == T_OBJECT, "just checking"); + oop obj = (oop) result.get_jobject(); + if (!HAS_PENDING_EXCEPTION && (obj != NULL)) { + if (non_array) { + klass = InstanceKlass::cast(java_lang_Class::as_Klass(obj)); + } else { + klass = static_cast(java_lang_Class::array_klass_acquire(obj)); + } + } else { // load classes in bootclasspath/a + if (HAS_PENDING_EXCEPTION) { + CLEAR_PENDING_EXCEPTION; + } + + if (non_array) { + Klass* k = SystemDictionary::resolve_or_null(class_name_symbol, CHECK_NULL); + if (k != NULL) { + klass = InstanceKlass::cast(k); + } else { + if (!HAS_PENDING_EXCEPTION) { + THROW_NULL(vmSymbols::java_lang_ClassNotFoundException()); + } + } + } + } + } else { + // If "source:" tag is specified, all super class and super interfaces must be specified in the + // class list file. + if (UseAppCDS) { + klass = load_class_from_source(class_name_symbol, CHECK_NULL); + } + } + + if (klass != NULL && is_id_specified()) { + int id = this->id(); + SystemDictionaryShared::update_shared_entry(klass, id); + InstanceKlass* old = table()->lookup(id); + if (old != NULL && old != klass) { + error("Duplicated ID %d for class %s", id, _class_name); + } + table()->add(id, klass); + } + + return klass; +} + +bool ClassListParser::is_loading_from_source() { + return (_source != NULL); +} + +InstanceKlass* ClassListParser::lookup_class_by_id(int id) { + InstanceKlass* klass = table()->lookup(id); + if (klass == NULL) { + error("Class ID %d has not been defined", id); + } + return klass; +} + + +InstanceKlass* ClassListParser::lookup_super_for_current_class(Symbol* super_name) { + if (!is_loading_from_source()) { + return NULL; + } + + InstanceKlass* k = lookup_class_by_id(super()); + if (super_name != k->name()) { + error("The specified super class %s (id %d) does not match actual super class %s", + k->name()->as_klass_external_name(), super(), + super_name->as_klass_external_name()); + } + return k; +} + +InstanceKlass* ClassListParser::lookup_interface_for_current_class(Symbol* interface_name) { + if (!is_loading_from_source()) { + return NULL; + } + + const int n = _interfaces->length(); + if (n == 0) { + error("Class %s implements the interface %s, but no interface has been specified in the input line", + _class_name, interface_name->as_klass_external_name()); + ShouldNotReachHere(); + } + + int i; + for (i=0; iat(i)); + if (interface_name == k->name()) { + return k; + } + } + + // interface_name is not specified by the "interfaces:" keyword. + print_specified_interfaces(); + error("The interface %s implemented by class %s does not match any of the specified interface IDs", + interface_name->as_klass_external_name(), _class_name); + ShouldNotReachHere(); + return NULL; +} + diff --git a/src/hotspot/share/classfile/classListParser.hpp b/src/hotspot/share/classfile/classListParser.hpp index 912ae3175a3..e6d48f41c8d 100644 --- a/src/hotspot/share/classfile/classListParser.hpp +++ b/src/hotspot/share/classfile/classListParser.hpp @@ -1,5 +1,5 @@ /* - * Copyright (c) 2015, Oracle and/or its affiliates. All rights reserved. + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. * * This code is free software; you can redistribute it and/or modify it @@ -27,30 +27,122 @@ #include "utilities/exceptions.hpp" #include "utilities/globalDefinitions.hpp" +#include "utilities/hashtable.hpp" + +class CDSClassInfo; + +// Look up from ID -> InstanceKlass* +class ID2KlassTable : public Hashtable { +public: + ID2KlassTable() : Hashtable(1987, sizeof(HashtableEntry)) { } + void add(int id, InstanceKlass* klass) { + unsigned int hash = (unsigned int)id; + HashtableEntry* entry = new_entry(hash, klass); + add_entry(hash_to_index(hash), entry); + } + + InstanceKlass* lookup(int id) { + unsigned int hash = (unsigned int)id; + int index = hash_to_index(id); + for (HashtableEntry* e = bucket(index); e != NULL; e = e->next()) { + if (e->hash() == hash) { + return e->literal(); + } + } + return NULL; + } +}; class ClassListParser : public StackObj { enum { + _unspecified = -999, + // Max number of bytes allowed per line in the classlist. - // Theoretically Java class names could be 65535 bytes in length. In reality, + // Theoretically Java class names could be 65535 bytes in length. Also, an input line + // could have a very long path name up to JVM_MAXPATHLEN bytes in length. In reality, // 4K bytes is more than enough. _max_allowed_line_len = 4096, _line_buf_extra = 10, // for detecting input too long _line_buf_size = _max_allowed_line_len + _line_buf_extra }; + static ClassListParser* _instance; // the singleton. const char* _classlist_file; FILE* _file; - char _line[_line_buf_size]; // The buffer that holds the current line. + ID2KlassTable _id2klass_table; + + // The following field contains information from the *current* line being + // parsed. + char _line[_line_buf_size]; // The buffer that holds the current line. Some characters in + // the buffer may be overwritten by '\0' during parsing. + int _line_len; // Original length of the input line. + int _line_no; // Line number for current line being parsed + const char* _class_name; + int _id; + int _super; + GrowableArray* _interfaces; + bool _interfaces_specified; + const char* _source; + + bool parse_int_option(const char* option_name, int* value); + InstanceKlass* load_class_from_source(Symbol* class_name, TRAPS); + ID2KlassTable *table() { + return &_id2klass_table; + } + InstanceKlass* lookup_class_by_id(int id); + void print_specified_interfaces(); + void print_actual_interfaces(InstanceKlass *ik); public: ClassListParser(const char* file); ~ClassListParser(); + + static ClassListParser* instance() { + return _instance; + } bool parse_one_line(); + char* _token; + void error(const char* msg, ...); + void parse_int(int* value); + bool try_parse_int(int* value); + bool skip_token(const char* option_name); + void skip_whitespaces(); + void skip_non_whitespaces(); + + bool is_id_specified() { + return _id != _unspecified; + } + bool is_super_specified() { + return _super != _unspecified; + } + bool are_interfaces_specified() { + return _interfaces->length() > 0; + } + int id() { + assert(is_id_specified(), "do not query unspecified id"); + return _id; + } + int super() { + assert(is_super_specified(), "do not query unspecified super"); + return _super; + } + void check_already_loaded(const char* which, int id) { + if (_id2klass_table.lookup(id) == NULL) { + error("%s id %d is not yet loaded", which, id); + } + } const char* current_class_name() { - return _line; + return _class_name; } + + InstanceKlass* load_current_class(TRAPS); + + bool is_loading_from_source(); + + // Look up the super or interface of the current class being loaded + // (in this->load_current_class()). + InstanceKlass* lookup_super_for_current_class(Symbol* super_name); + InstanceKlass* lookup_interface_for_current_class(Symbol* interface_name); }; - - -#endif // SHARE_VM_MEMORY_CLASSLISTPARSER_HPP +#endif diff --git a/src/hotspot/share/classfile/classLoaderExt.cpp b/src/hotspot/share/classfile/classLoaderExt.cpp index 44efabec083..a7256bb8e72 100644 --- a/src/hotspot/share/classfile/classLoaderExt.cpp +++ b/src/hotspot/share/classfile/classLoaderExt.cpp @@ -1,5 +1,5 @@ /* - * Copyright (c) 2015, Oracle and/or its affiliates. All rights reserved. + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. * * This code is free software; you can redistribute it and/or modify it @@ -23,14 +23,329 @@ */ #include "precompiled.hpp" +#include "classfile/classFileParser.hpp" +#include "classfile/classFileStream.hpp" #include "classfile/classListParser.hpp" +#include "classfile/classLoader.hpp" #include "classfile/classLoaderExt.hpp" -#include "classfile/symbolTable.hpp" -#include "classfile/systemDictionary.hpp" +#include "classfile/classLoaderData.inline.hpp" +#include "classfile/klassFactory.hpp" +#include "classfile/sharedClassUtil.hpp" +#include "classfile/sharedPathsMiscInfo.hpp" +#include "classfile/systemDictionaryShared.hpp" +#include "classfile/vmSymbols.hpp" +#include "memory/allocation.inline.hpp" +#include "memory/filemap.hpp" +#include "memory/resourceArea.hpp" +#include "oops/instanceKlass.hpp" +#include "oops/oop.inline.hpp" +#include "oops/symbol.hpp" +#include "runtime/arguments.hpp" +#include "runtime/java.hpp" +#include "runtime/javaCalls.hpp" +#include "runtime/os.hpp" +#include "services/threadService.hpp" +#include "utilities/stringUtils.hpp" +jshort ClassLoaderExt::_app_paths_start_index = ClassLoaderExt::max_classpath_index; +bool ClassLoaderExt::_has_app_classes = false; +bool ClassLoaderExt::_has_platform_classes = false; + +void ClassLoaderExt::setup_app_search_path() { + assert(DumpSharedSpaces, "this function is only used with -Xshare:dump and -XX:+UseAppCDS"); + _app_paths_start_index = ClassLoader::num_boot_classpath_entries(); + char* app_class_path = os::strdup(Arguments::get_appclasspath()); + + if (strcmp(app_class_path, ".") == 0) { + // This doesn't make any sense, even for AppCDS, so let's skip it. We + // don't want to throw an error here because -cp "." is usually assigned + // by the launcher when classpath is not specified. + trace_class_path("app loader class path (skipped)=", app_class_path); + } else { + trace_class_path("app loader class path=", app_class_path); + shared_paths_misc_info()->add_app_classpath(app_class_path); + ClassLoader::setup_app_search_path(app_class_path); + } +} + +char* ClassLoaderExt::read_manifest(ClassPathEntry* entry, jint *manifest_size, bool clean_text, TRAPS) { + const char* name = "META-INF/MANIFEST.MF"; + char* manifest; + jint size; + + assert(entry->is_jar_file(), "must be"); + manifest = (char*) ((ClassPathZipEntry*)entry )->open_entry(name, &size, true, CHECK_NULL); + + if (manifest == NULL) { // No Manifest + *manifest_size = 0; + return NULL; + } + + + if (clean_text) { + // See http://docs.oracle.com/javase/6/docs/technotes/guides/jar/jar.html#JAR%20Manifest + // (1): replace all CR/LF and CR with LF + StringUtils::replace_no_expand(manifest, "\r\n", "\n"); + + // (2) remove all new-line continuation (remove all "\n " substrings) + StringUtils::replace_no_expand(manifest, "\n ", ""); + } + + *manifest_size = (jint)strlen(manifest); + return manifest; +} + +char* ClassLoaderExt::get_class_path_attr(const char* jar_path, char* manifest, jint manifest_size) { + const char* tag = "Class-Path: "; + const int tag_len = (int)strlen(tag); + char* found = NULL; + char* line_start = manifest; + char* end = manifest + manifest_size; + + assert(*end == 0, "must be nul-terminated"); + + while (line_start < end) { + char* line_end = strchr(line_start, '\n'); + if (line_end == NULL) { + // JAR spec require the manifest file to be terminated by a new line. + break; + } + if (strncmp(tag, line_start, tag_len) == 0) { + if (found != NULL) { + // Same behavior as jdk/src/share/classes/java/util/jar/Attributes.java + // If duplicated entries are found, the last one is used. + tty->print_cr("Warning: Duplicate name in Manifest: %s.\n" + "Ensure that the manifest does not have duplicate entries, and\n" + "that blank lines separate individual sections in both your\n" + "manifest and in the META-INF/MANIFEST.MF entry in the jar file:\n%s\n", tag, jar_path); + } + found = line_start + tag_len; + assert(found <= line_end, "sanity"); + *line_end = '\0'; + } + line_start = line_end + 1; + } + return found; +} + +void ClassLoaderExt::process_jar_manifest(ClassPathEntry* entry, + bool check_for_duplicates) { + Thread* THREAD = Thread::current(); + ResourceMark rm(THREAD); + jint manifest_size; + char* manifest = read_manifest(entry, &manifest_size, CHECK); + + if (manifest == NULL) { + return; + } + + if (strstr(manifest, "Extension-List:") != NULL) { + tty->print_cr("-Xshare:dump does not support Extension-List in JAR manifest: %s", entry->name()); + vm_exit(1); + } + + char* cp_attr = get_class_path_attr(entry->name(), manifest, manifest_size); + + if (cp_attr != NULL && strlen(cp_attr) > 0) { + trace_class_path("found Class-Path: ", cp_attr); + + char sep = os::file_separator()[0]; + const char* dir_name = entry->name(); + const char* dir_tail = strrchr(dir_name, sep); + int dir_len; + if (dir_tail == NULL) { + dir_len = 0; + } else { + dir_len = dir_tail - dir_name + 1; + } + + // Split the cp_attr by spaces, and add each file + char* file_start = cp_attr; + char* end = file_start + strlen(file_start); + + while (file_start < end) { + char* file_end = strchr(file_start, ' '); + if (file_end != NULL) { + *file_end = 0; + file_end += 1; + } else { + file_end = end; + } + + int name_len = (int)strlen(file_start); + if (name_len > 0) { + ResourceMark rm(THREAD); + char* libname = NEW_RESOURCE_ARRAY(char, dir_len + name_len + 1); + *libname = 0; + strncat(libname, dir_name, dir_len); + strncat(libname, file_start, name_len); + trace_class_path("library = ", libname); + ClassLoader::update_class_path_entry_list(libname, true, false); + } + + file_start = file_end; + } + } +} + +void ClassLoaderExt::setup_search_paths() { + if (UseAppCDS) { + shared_paths_misc_info()->record_app_offset(); + ClassLoaderExt::setup_app_search_path(); + } +} + +Thread* ClassLoaderExt::Context::_dump_thread = NULL; + +bool ClassLoaderExt::check(ClassLoaderExt::Context *context, + const ClassFileStream* stream, + const int classpath_index) { + if (stream != NULL) { + // Ignore any App classes from signed JAR file during CDS archiving + // dumping + if (DumpSharedSpaces && + SharedClassUtil::is_classpath_entry_signed(classpath_index) && + classpath_index >= _app_paths_start_index) { + tty->print_cr("Preload Warning: Skipping %s from signed JAR", + context->class_name()); + return false; + } + if (classpath_index >= _app_paths_start_index) { + _has_app_classes = true; + _has_platform_classes = true; + } + } + + return true; +} + +void ClassLoaderExt::record_result(ClassLoaderExt::Context *context, + Symbol* class_name, + const s2 classpath_index, + InstanceKlass* result, + TRAPS) { + assert(DumpSharedSpaces, "Sanity"); + + // We need to remember where the class comes from during dumping. + oop loader = result->class_loader(); + s2 classloader_type = ClassLoader::BOOT_LOADER; + if (SystemDictionary::is_system_class_loader(loader)) { + classloader_type = ClassLoader::APP_LOADER; + ClassLoaderExt::set_has_app_classes(); + } else if (SystemDictionary::is_platform_class_loader(loader)) { + classloader_type = ClassLoader::PLATFORM_LOADER; + ClassLoaderExt::set_has_platform_classes(); + } + result->set_shared_classpath_index(classpath_index); + result->set_class_loader_type(classloader_type); +} + +void ClassLoaderExt::finalize_shared_paths_misc_info() { + if (UseAppCDS) { + if (!_has_app_classes) { + shared_paths_misc_info()->pop_app(); + } + } +} + +// Load the class of the given name from the location given by path. The path is specified by +// the "source:" in the class list file (see classListParser.cpp), and can be a directory or +// a JAR file. +InstanceKlass* ClassLoaderExt::load_class(Symbol* name, const char* path, TRAPS) { + + assert(name != NULL, "invariant"); + assert(DumpSharedSpaces && UseAppCDS, "this function is only used with -Xshare:dump and -XX:+UseAppCDS"); + ResourceMark rm(THREAD); + const char* class_name = name->as_C_string(); + + const char* file_name = file_name_for_class_name(class_name, + name->utf8_length()); + assert(file_name != NULL, "invariant"); + + // Lookup stream for parsing .class file + ClassFileStream* stream = NULL; + ClassPathEntry* e = find_classpath_entry_from_cache(path, CHECK_NULL); + if (e == NULL) { + return NULL; + } + { + PerfClassTraceTime vmtimer(perf_sys_class_lookup_time(), + ((JavaThread*) THREAD)->get_thread_stat()->perf_timers_addr(), + PerfClassTraceTime::CLASS_LOAD); + stream = e->open_stream(file_name, CHECK_NULL); + } + + if (NULL == stream) { + tty->print_cr("Preload Warning: Cannot find %s", class_name); + return NULL; + } + + assert(stream != NULL, "invariant"); + stream->set_verify(true); + + ClassLoaderData* loader_data = ClassLoaderData::the_null_class_loader_data(); + Handle protection_domain; + + InstanceKlass* result = KlassFactory::create_from_stream(stream, + name, + loader_data, + protection_domain, + NULL, // host_klass + NULL, // cp_patches + THREAD); + + if (HAS_PENDING_EXCEPTION) { + tty->print_cr("Preload Error: Failed to load %s", class_name); + return NULL; + } + result->set_shared_classpath_index(UNREGISTERED_INDEX); + SystemDictionaryShared::set_shared_class_misc_info(result, stream); + return result; +} + +struct CachedClassPathEntry { + const char* _path; + ClassPathEntry* _entry; +}; + +static GrowableArray* cached_path_entries = NULL; + +ClassPathEntry* ClassLoaderExt::find_classpath_entry_from_cache(const char* path, TRAPS) { + // This is called from dump time so it's single threaded and there's no need for a lock. + assert(DumpSharedSpaces && UseAppCDS, "this function is only used with -Xshare:dump and -XX:+UseAppCDS"); + if (cached_path_entries == NULL) { + cached_path_entries = new (ResourceObj::C_HEAP, mtClass) GrowableArray(20, /*c heap*/ true); + } + CachedClassPathEntry ccpe; + for (int i=0; ilength(); i++) { + ccpe = cached_path_entries->at(i); + if (strcmp(ccpe._path, path) == 0) { + if (i != 0) { + // Put recent entries at the beginning to speed up searches. + cached_path_entries->remove_at(i); + cached_path_entries->insert_before(0, ccpe); + } + return ccpe._entry; + } + } + + struct stat st; + if (os::stat(path, &st) != 0) { + // File or directory not found + return NULL; + } + ClassPathEntry* new_entry = NULL; + + new_entry = create_class_path_entry(path, &st, false, false, CHECK_NULL); + if (new_entry == NULL) { + return NULL; + } + ccpe._path = strdup(path); + ccpe._entry = new_entry; + cached_path_entries->insert_before(0, ccpe); + return new_entry; +} Klass* ClassLoaderExt::load_one_class(ClassListParser* parser, TRAPS) { - TempNewSymbol class_name_symbol = SymbolTable::new_symbol(parser->current_class_name(), THREAD); - guarantee(!HAS_PENDING_EXCEPTION, "Exception creating a symbol."); - return SystemDictionary::resolve_or_null(class_name_symbol, THREAD); + return parser->load_current_class(THREAD); } diff --git a/src/hotspot/share/classfile/classLoaderExt.hpp b/src/hotspot/share/classfile/classLoaderExt.hpp index 09cb592b0d6..27e9ce25ef5 100644 --- a/src/hotspot/share/classfile/classLoaderExt.hpp +++ b/src/hotspot/share/classfile/classLoaderExt.hpp @@ -26,65 +26,152 @@ #define SHARE_VM_CLASSFILE_CLASSLOADEREXT_HPP #include "classfile/classLoader.hpp" -#include "classfile/systemDictionary.hpp" -#include "oops/instanceKlass.hpp" -#include "runtime/handles.hpp" +#include "utilities/macros.hpp" -class ClassListParser; +CDS_ONLY(class SharedPathsMiscInfoExt;) +CDS_ONLY(class ClassListParser;) class ClassLoaderExt: public ClassLoader { // AllStatic public: - + enum SomeConstants { + max_classpath_index = 0x7fff + }; + // ClassLoaderExt::Context -- + // + // This is used by DumpSharedSpaces only - it enforces the same classloader + // delegation model as would be in run-time. I.e., + // + classes defined by the NULL class loader cannot load classes in the PLATFORM or APP paths. + // + classes defined by the PLATFORM class loader cannot load classes in the APP paths. class Context { + static Thread* _dump_thread; + const char* _class_name; const char* _file_name; public: + const char* class_name() { + return _class_name; + } + const char* file_name() { + return _file_name; + } + Context(const char* class_name, const char* file_name, TRAPS) { + _class_name = class_name; _file_name = file_name; +#if INCLUDE_CDS + if (!DumpSharedSpaces && !UseSharedSpaces) { + // Must not modify _app_paths_start_index if we're not using CDS. + assert(_app_paths_start_index == ClassLoaderExt::max_classpath_index, "must be"); + } +#endif } bool check(const ClassFileStream* stream, const int classpath_index) { - return true; + CDS_ONLY(return ClassLoaderExt::check(this, stream, classpath_index);) + NOT_CDS(return true;) } bool should_verify(int classpath_index) { - return false; + CDS_ONLY(return (classpath_index >= _app_paths_start_index);) + NOT_CDS(return false;) } void record_result(Symbol* class_name, const s2 classpath_index, - InstanceKlass* result, TRAPS) { + InstanceKlass* result, + TRAPS) { #if INCLUDE_CDS - assert(DumpSharedSpaces, "Sanity"); - oop loader = result->class_loader(); - s2 classloader_type = ClassLoader::BOOT_LOADER; - if (SystemDictionary::is_system_class_loader(loader)) { - classloader_type = ClassLoader::APP_LOADER; - ClassLoaderExt::set_has_app_classes(); - } else if (SystemDictionary::is_platform_class_loader(loader)) { - classloader_type = ClassLoader::PLATFORM_LOADER; - ClassLoaderExt::set_has_platform_classes(); - } - result->set_shared_classpath_index(classpath_index); - result->set_class_loader_type(classloader_type); + ClassLoaderExt::record_result(this, class_name, classpath_index, result, THREAD); #endif } - }; + ~Context() { +#if INCLUDE_CDS + if (!DumpSharedSpaces && !UseSharedSpaces) { + // Must not modify app_paths_start_index if we're not using CDS. + assert(_app_paths_start_index == ClassLoaderExt::max_classpath_index, "must be"); + } +#endif + } + }; // end ClassLoaderExt::Context + +private: +#if INCLUDE_CDS + static char* get_class_path_attr(const char* jar_path, char* manifest, jint manifest_size); + static void setup_app_search_path(); // Only when -Xshare:dump + static SharedPathsMiscInfoExt* shared_paths_misc_info() { + return (SharedPathsMiscInfoExt*)_shared_paths_misc_info; + } + static jshort _app_paths_start_index; // index of first app JAR in shared classpath entry table + static bool _has_app_classes; + static bool _has_platform_classes; +#endif + +public: + CDS_ONLY(static void process_jar_manifest(ClassPathEntry* entry, bool check_for_duplicates);) + + // Called by JVMTI code to add boot classpath static void append_boot_classpath(ClassPathEntry* new_entry) { +#if INCLUDE_CDS + if (UseAppCDS) { + warning("UseAppCDS is disabled because bootstrap classpath has been appended"); + UseAppCDS = false; + } +#endif ClassLoader::add_to_boot_append_entries(new_entry); } - static void setup_search_paths() {} - static bool is_boot_classpath(int classpath_index) { - return true; - } - static Klass* load_one_class(ClassListParser* parser, TRAPS); + + static void setup_search_paths() NOT_CDS_RETURN; + #if INCLUDE_CDS - static void set_has_app_classes() {} - static void set_has_platform_classes() {} +private: + static char* read_manifest(ClassPathEntry* entry, jint *manifest_size, bool clean_text, TRAPS); + static ClassPathEntry* find_classpath_entry_from_cache(const char* path, TRAPS); + +public: static char* read_manifest(ClassPathEntry* entry, jint *manifest_size, TRAPS) { - return NULL; + // Remove all the new-line continuations (which wrap long lines at 72 characters, see + // http://docs.oracle.com/javase/6/docs/technotes/guides/jar/jar.html#JAR%20Manifest), so + // that the manifest is easier to parse. + return read_manifest(entry, manifest_size, true, THREAD); + } + static char* read_raw_manifest(ClassPathEntry* entry, jint *manifest_size, TRAPS) { + // Do not remove new-line continuations, so we can easily pass it as an argument to + // java.util.jar.Manifest.getManifest() at run-time. + return read_manifest(entry, manifest_size, false, THREAD); + } + + static void finalize_shared_paths_misc_info(); + + static jshort app_paths_start_index() { return _app_paths_start_index; } + + static void init_paths_start_index(jshort app_start) { + _app_paths_start_index = app_start; + } + + static bool is_boot_classpath(int classpath_index) { + return classpath_index < _app_paths_start_index; + } + + static bool has_platform_or_app_classes() { + return _has_app_classes || _has_platform_classes; + } + + static bool check(class ClassLoaderExt::Context *context, + const ClassFileStream* stream, + const int classpath_index); + + static void record_result(class ClassLoaderExt::Context *context, + Symbol* class_name, + const s2 classpath_index, + InstanceKlass* result, TRAPS); + static InstanceKlass* load_class(Symbol* h_name, const char* path, TRAPS); + static Klass* load_one_class(ClassListParser* parser, TRAPS); + static void set_has_app_classes() { + _has_app_classes = true; + } + static void set_has_platform_classes() { + _has_platform_classes = true; } - static void process_jar_manifest(ClassPathEntry* entry, bool check_for_duplicates) {} #endif }; diff --git a/src/hotspot/share/classfile/sharedClassUtil.cpp b/src/hotspot/share/classfile/sharedClassUtil.cpp new file mode 100644 index 00000000000..4d713cae863 --- /dev/null +++ b/src/hotspot/share/classfile/sharedClassUtil.cpp @@ -0,0 +1,248 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +#include "precompiled.hpp" +#include "classfile/classLoader.hpp" +#include "classfile/classLoaderExt.hpp" +#include "classfile/dictionary.hpp" +#include "classfile/javaClasses.hpp" +#include "classfile/sharedClassUtil.hpp" +#include "classfile/stringTable.hpp" +#include "classfile/symbolTable.hpp" +#include "classfile/systemDictionary.hpp" +#include "classfile/systemDictionaryShared.hpp" +#include "memory/filemap.hpp" +#include "memory/metadataFactory.hpp" +#include "memory/resourceArea.hpp" +#include "oops/instanceKlass.hpp" +#include "runtime/arguments.hpp" +#include "runtime/java.hpp" +#include "runtime/os.hpp" + +class ManifestStream: public ResourceObj { + private: + u1* _buffer_start; // Buffer bottom + u1* _buffer_end; // Buffer top (one past last element) + u1* _current; // Current buffer position + + public: + // Constructor + ManifestStream(u1* buffer, int length) : _buffer_start(buffer), + _current(buffer) { + _buffer_end = buffer + length; + } + + static bool is_attr(u1* attr, const char* name) { + return strncmp((const char*)attr, name, strlen(name)) == 0; + } + + static char* copy_attr(u1* value, size_t len) { + char* buf = NEW_RESOURCE_ARRAY(char, len + 1); + strncpy(buf, (char*)value, len); + buf[len] = 0; + return buf; + } + + // The return value indicates if the JAR is signed or not + bool check_is_signed() { + u1* attr = _current; + bool isSigned = false; + while (_current < _buffer_end) { + if (*_current == '\n') { + *_current = '\0'; + u1* value = (u1*)strchr((char*)attr, ':'); + if (value != NULL) { + assert(*(value+1) == ' ', "Unrecognized format" ); + if (strstr((char*)attr, "-Digest") != NULL) { + isSigned = true; + break; + } + } + *_current = '\n'; // restore + attr = _current + 1; + } + _current ++; + } + return isSigned; + } +}; + +void SharedPathsMiscInfoExt::print_path(outputStream* out, int type, const char* path) { + switch(type) { + case APP: + ClassLoader::trace_class_path("Expecting -Djava.class.path=", path); + break; + default: + SharedPathsMiscInfo::print_path(out, type, path); + } +} + +bool SharedPathsMiscInfoExt::check(jint type, const char* path) { + + switch (type) { + case APP: + { + // Prefix is OK: E.g., dump with -cp foo.jar, but run with -cp foo.jar:bar.jar + size_t len = strlen(path); + const char *appcp = Arguments::get_appclasspath(); + assert(appcp != NULL, "NULL app classpath"); + size_t appcp_len = strlen(appcp); + if (appcp_len < len) { + return fail("Run time APP classpath is shorter than the one at dump time: ", appcp); + } + ResourceMark rm; + char* tmp_path; + if (len == appcp_len) { + tmp_path = (char*)appcp; + } else { + tmp_path = NEW_RESOURCE_ARRAY(char, len + 1); + strncpy(tmp_path, appcp, len); + tmp_path[len] = 0; + } + if (os::file_name_strcmp(path, tmp_path) != 0) { + return fail("[APP classpath mismatch, actual: -Djava.class.path=", appcp); + } + if (appcp[len] != '\0' && appcp[len] != os::path_separator()[0]) { + return fail("Dump time APP classpath is not a proper prefix of run time APP classpath: ", appcp); + } + } + break; + default: + return SharedPathsMiscInfo::check(type, path); + } + + return true; +} + +void SharedClassUtil::update_shared_classpath(ClassPathEntry *cpe, SharedClassPathEntry* e, TRAPS) { + ClassLoaderData* loader_data = ClassLoaderData::the_null_class_loader_data(); + SharedClassPathEntryExt* ent = (SharedClassPathEntryExt*)e; + ResourceMark rm(THREAD); + jint manifest_size; + bool isSigned; + char* manifest = ClassLoaderExt::read_manifest(cpe, &manifest_size, CHECK); + if (manifest != NULL) { + ManifestStream* stream = new ManifestStream((u1*)manifest, + manifest_size); + isSigned = stream->check_is_signed(); + if (isSigned) { + ent->_is_signed = true; + } else { + // Copy the manifest into the shared archive + manifest = ClassLoaderExt::read_raw_manifest(cpe, &manifest_size, CHECK); + Array* buf = MetadataFactory::new_array(loader_data, + manifest_size, + THREAD); + char* p = (char*)(buf->data()); + memcpy(p, manifest, manifest_size); + ent->set_manifest(buf); + ent->_is_signed = false; + } + } +} + +void SharedClassUtil::initialize(TRAPS) { + if (UseSharedSpaces) { + int size = FileMapInfo::get_number_of_share_classpaths(); + if (size > 0) { + SystemDictionaryShared::allocate_shared_data_arrays(size, THREAD); + if (!DumpSharedSpaces) { + FileMapHeaderExt* header = (FileMapHeaderExt*)FileMapInfo::current_info()->header(); + ClassLoaderExt::init_paths_start_index(header->_app_paths_start_index); + } + } + } + + if (DumpSharedSpaces) { + if (SharedArchiveConfigFile) { + read_extra_data(SharedArchiveConfigFile, THREAD); + } + } +} + +void SharedClassUtil::read_extra_data(const char* filename, TRAPS) { + HashtableTextDump reader(filename); + reader.check_version("VERSION: 1.0"); + + while (reader.remain() > 0) { + int utf8_length; + int prefix_type = reader.scan_prefix(&utf8_length); + ResourceMark rm(THREAD); + char* utf8_buffer = NEW_RESOURCE_ARRAY(char, utf8_length); + reader.get_utf8(utf8_buffer, utf8_length); + + if (prefix_type == HashtableTextDump::SymbolPrefix) { + SymbolTable::new_symbol(utf8_buffer, utf8_length, THREAD); + } else{ + assert(prefix_type == HashtableTextDump::StringPrefix, "Sanity"); + utf8_buffer[utf8_length] = '\0'; + oop s = StringTable::intern(utf8_buffer, THREAD); + } + } +} + +bool SharedClassUtil::is_classpath_entry_signed(int classpath_index) { + assert(classpath_index >= 0, "Sanity"); + SharedClassPathEntryExt* ent = (SharedClassPathEntryExt*) + FileMapInfo::shared_classpath(classpath_index); + return ent->_is_signed; +} + +void FileMapHeaderExt::populate(FileMapInfo* mapinfo, size_t alignment) { + FileMapInfo::FileMapHeader::populate(mapinfo, alignment); + + ClassLoaderExt::finalize_shared_paths_misc_info(); + _app_paths_start_index = ClassLoaderExt::app_paths_start_index(); + + _verify_local = BytecodeVerificationLocal; + _verify_remote = BytecodeVerificationRemote; + _has_platform_or_app_classes = ClassLoaderExt::has_platform_or_app_classes(); +} + +bool FileMapHeaderExt::validate() { + if (UseAppCDS) { + const char* prop = Arguments::get_property("java.system.class.loader"); + if (prop != NULL) { + warning("UseAppCDS is disabled because the java.system.class.loader property is specified (value = \"%s\"). " + "To enable UseAppCDS, this property must be not be set", prop); + UseAppCDS = false; + } + } + + if (!FileMapInfo::FileMapHeader::validate()) { + return false; + } + + // For backwards compatibility, we don't check the verification setting + // if the archive only contains system classes. + if (_has_platform_or_app_classes && + ((!_verify_local && BytecodeVerificationLocal) || + (!_verify_remote && BytecodeVerificationRemote))) { + FileMapInfo::fail_continue("The shared archive file was created with less restrictive " + "verification setting than the current setting."); + return false; + } + + return true; +} diff --git a/src/hotspot/share/classfile/sharedClassUtil.hpp b/src/hotspot/share/classfile/sharedClassUtil.hpp index 236087f1871..c3b7f603466 100644 --- a/src/hotspot/share/classfile/sharedClassUtil.hpp +++ b/src/hotspot/share/classfile/sharedClassUtil.hpp @@ -27,37 +27,108 @@ #include "classfile/sharedPathsMiscInfo.hpp" #include "memory/filemap.hpp" +#include "classfile/classLoaderExt.hpp" +#include "classfile/dictionary.hpp" +#include "classfile/systemDictionaryShared.hpp" +#include "oops/klass.hpp" -class SharedClassUtil : AllStatic { +class FileMapHeaderExt: public FileMapInfo::FileMapHeader { public: + jshort _app_paths_start_index; // Index of first app classpath entry + bool _verify_local; // BytecodeVerificationLocal setting + bool _verify_remote; // BytecodeVerificationRemote setting + bool _has_platform_or_app_classes; // Archive contains app classes - static SharedPathsMiscInfo* allocate_shared_paths_misc_info() { - return new SharedPathsMiscInfo(); + FileMapHeaderExt() { + _has_platform_or_app_classes = true; + } + virtual void populate(FileMapInfo* mapinfo, size_t alignment); + virtual bool validate(); +}; + +// In addition to SharedPathsMiscInfo, the following information is also stored +// +// +// + The value of Arguments::get_appclasspath() used during dumping. +// +class SharedPathsMiscInfoExt : public SharedPathsMiscInfo { +private: + int _app_offset; +public: + enum { + APP = 5 + }; + + virtual const char* type_name(int type) { + switch (type) { + case APP: return "APP"; + default: return SharedPathsMiscInfo::type_name(type); + } } - static SharedPathsMiscInfo* allocate_shared_paths_misc_info(char* buf, int size) { - return new SharedPathsMiscInfo(buf, size); + virtual void print_path(outputStream* out, int type, const char* path); + + SharedPathsMiscInfoExt() : SharedPathsMiscInfo() { + _app_offset = 0; + } + SharedPathsMiscInfoExt(char* buf, int size) : SharedPathsMiscInfo(buf, size) { + _app_offset = 0; } - static FileMapInfo::FileMapHeader* allocate_file_map_header() { - return new FileMapInfo::FileMapHeader(); + virtual bool check(jint type, const char* path); + + void add_app_classpath(const char* path) { + add_path(path, APP); } - static size_t file_map_header_size() { - return sizeof(FileMapInfo::FileMapHeader); + void record_app_offset() { + _app_offset = get_used_bytes(); } - - static size_t shared_class_path_entry_size() { - return sizeof(SharedClassPathEntry); - } - - static void update_shared_classpath(ClassPathEntry *cpe, - SharedClassPathEntry* ent, TRAPS) {} - static void initialize(TRAPS) {} - - inline static bool is_shared_boot_class(Klass* klass) { - return (klass->_shared_class_path_index >= 0); + void pop_app() { + _cur_ptr = _buf_start + _app_offset; + write_jint(0); } }; +class SharedClassPathEntryExt: public SharedClassPathEntry { +public: + //Maniest attributes + bool _is_signed; + void set_manifest(Array* manifest) { + _manifest = manifest; + } +}; + +class SharedClassUtil : AllStatic { +public: + static SharedPathsMiscInfo* allocate_shared_paths_misc_info() { + return new SharedPathsMiscInfoExt(); + } + + static SharedPathsMiscInfo* allocate_shared_paths_misc_info(char* buf, int size) { + return new SharedPathsMiscInfoExt(buf, size); + } + + static FileMapInfo::FileMapHeader* allocate_file_map_header() { + return new FileMapHeaderExt(); + } + + static size_t file_map_header_size() { + return sizeof(FileMapHeaderExt); + } + + static size_t shared_class_path_entry_size() { + return sizeof(SharedClassPathEntryExt); + } + + static void update_shared_classpath(ClassPathEntry *cpe, SharedClassPathEntry* ent, TRAPS); + static void initialize(TRAPS); + +private: + static void read_extra_data(const char* filename, TRAPS); + +public: + static bool is_classpath_entry_signed(int classpath_index); +}; + #endif // SHARE_VM_CLASSFILE_SHAREDCLASSUTIL_HPP diff --git a/src/hotspot/share/classfile/systemDictionary.cpp b/src/hotspot/share/classfile/systemDictionary.cpp index df4a38f0306..f760c758273 100644 --- a/src/hotspot/share/classfile/systemDictionary.cpp +++ b/src/hotspot/share/classfile/systemDictionary.cpp @@ -1087,7 +1087,7 @@ InstanceKlass* SystemDictionary::resolve_from_stream(Symbol* class_name, #if INCLUDE_CDS ResourceMark rm(THREAD); if (DumpSharedSpaces && !class_loader.is_null() && - !ArgumentsExt::using_AppCDS() && strcmp(class_name->as_C_string(), "Unnamed") != 0) { + !UseAppCDS && strcmp(class_name->as_C_string(), "Unnamed") != 0) { // If AppCDS is not enabled, don't define the class at dump time (except for the "Unnamed" // class, which is used by MethodHandles). THROW_MSG_NULL(vmSymbols::java_lang_ClassNotFoundException(), class_name->as_C_string()); diff --git a/src/hotspot/share/classfile/systemDictionaryShared.cpp b/src/hotspot/share/classfile/systemDictionaryShared.cpp new file mode 100644 index 00000000000..692ba891823 --- /dev/null +++ b/src/hotspot/share/classfile/systemDictionaryShared.cpp @@ -0,0 +1,1086 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +#include "precompiled.hpp" +#include "classfile/classFileStream.hpp" +#include "classfile/classListParser.hpp" +#include "classfile/classLoader.hpp" +#include "classfile/classLoaderData.inline.hpp" +#include "classfile/classLoaderExt.hpp" +#include "classfile/compactHashtable.inline.hpp" +#include "classfile/dictionary.hpp" +#include "classfile/javaClasses.hpp" +#include "classfile/sharedClassUtil.hpp" +#include "classfile/symbolTable.hpp" +#include "classfile/systemDictionary.hpp" +#include "classfile/systemDictionaryShared.hpp" +#include "classfile/verificationType.hpp" +#include "classfile/vmSymbols.hpp" +#include "logging/log.hpp" +#include "memory/allocation.hpp" +#include "memory/filemap.hpp" +#include "memory/metadataFactory.hpp" +#include "memory/metaspaceClosure.hpp" +#include "memory/oopFactory.hpp" +#include "memory/resourceArea.hpp" +#include "oops/instanceKlass.hpp" +#include "oops/klass.inline.hpp" +#include "oops/objArrayOop.inline.hpp" +#include "oops/oop.inline.hpp" +#include "runtime/java.hpp" +#include "runtime/javaCalls.hpp" +#include "runtime/mutexLocker.hpp" +#include "utilities/hashtable.inline.hpp" +#include "utilities/stringUtils.hpp" + + +objArrayOop SystemDictionaryShared::_shared_protection_domains = NULL; +objArrayOop SystemDictionaryShared::_shared_jar_urls = NULL; +objArrayOop SystemDictionaryShared::_shared_jar_manifests = NULL; + +static Mutex* SharedDictionary_lock = NULL; + +void SystemDictionaryShared::initialize(TRAPS) { + if (_java_system_loader != NULL) { + SharedDictionary_lock = new Mutex(Mutex::leaf, "SharedDictionary_lock", true); + + // These classes need to be initialized before calling get_shared_jar_manifest(), etc. + SystemDictionary::ByteArrayInputStream_klass()->initialize(CHECK); + SystemDictionary::File_klass()->initialize(CHECK); + SystemDictionary::Jar_Manifest_klass()->initialize(CHECK); + SystemDictionary::CodeSource_klass()->initialize(CHECK); + } +} + +oop SystemDictionaryShared::shared_protection_domain(int index) { + return _shared_protection_domains->obj_at(index); +} + +oop SystemDictionaryShared::shared_jar_url(int index) { + return _shared_jar_urls->obj_at(index); +} + +oop SystemDictionaryShared::shared_jar_manifest(int index) { + return _shared_jar_manifests->obj_at(index); +} + + +Handle SystemDictionaryShared::get_shared_jar_manifest(int shared_path_index, TRAPS) { + Handle empty; + Handle manifest ; + if (shared_jar_manifest(shared_path_index) == NULL) { + SharedClassPathEntryExt* ent = (SharedClassPathEntryExt*)FileMapInfo::shared_classpath(shared_path_index); + long size = ent->manifest_size(); + if (size <= 0) { + return empty; // No manifest - return NULL handle + } + + // ByteArrayInputStream bais = new ByteArrayInputStream(buf); + InstanceKlass* bais_klass = SystemDictionary::ByteArrayInputStream_klass(); + Handle bais = bais_klass->allocate_instance_handle(CHECK_(empty)); + { + const char* src = ent->manifest(); + assert(src != NULL, "No Manifest data"); + typeArrayOop buf = oopFactory::new_byteArray(size, CHECK_(empty)); + typeArrayHandle bufhandle(THREAD, buf); + char* dst = (char*)(buf->byte_at_addr(0)); + memcpy(dst, src, (size_t)size); + + JavaValue result(T_VOID); + JavaCalls::call_special(&result, bais, bais_klass, + vmSymbols::object_initializer_name(), + vmSymbols::byte_array_void_signature(), + bufhandle, CHECK_(empty)); + } + + // manifest = new Manifest(bais) + InstanceKlass* manifest_klass = SystemDictionary::Jar_Manifest_klass(); + manifest = manifest_klass->allocate_instance_handle(CHECK_(empty)); + { + JavaValue result(T_VOID); + JavaCalls::call_special(&result, manifest, manifest_klass, + vmSymbols::object_initializer_name(), + vmSymbols::input_stream_void_signature(), + bais, CHECK_(empty)); + } + atomic_set_shared_jar_manifest(shared_path_index, manifest()); + } + + manifest = Handle(THREAD, shared_jar_manifest(shared_path_index)); + assert(manifest.not_null(), "sanity"); + return manifest; +} + +Handle SystemDictionaryShared::get_shared_jar_url(int shared_path_index, TRAPS) { + Handle url_h; + if (shared_jar_url(shared_path_index) == NULL) { + JavaValue result(T_OBJECT); + const char* path = FileMapInfo::shared_classpath_name(shared_path_index); + Handle path_string = java_lang_String::create_from_str(path, CHECK_(url_h)); + Klass* classLoaders_klass = + SystemDictionary::jdk_internal_loader_ClassLoaders_klass(); + JavaCalls::call_static(&result, classLoaders_klass, + vmSymbols::toFileURL_name(), + vmSymbols::toFileURL_signature(), + path_string, CHECK_(url_h)); + + atomic_set_shared_jar_url(shared_path_index, (oop)result.get_jobject()); + } + + url_h = Handle(THREAD, shared_jar_url(shared_path_index)); + assert(url_h.not_null(), "sanity"); + return url_h; +} + +Handle SystemDictionaryShared::get_package_name(Symbol* class_name, TRAPS) { + ResourceMark rm(THREAD); + Handle pkgname_string; + char* pkgname = (char*) ClassLoader::package_from_name((const char*) class_name->as_C_string()); + if (pkgname != NULL) { // Package prefix found + StringUtils::replace_no_expand(pkgname, "/", "."); + pkgname_string = java_lang_String::create_from_str(pkgname, + CHECK_(pkgname_string)); + } + return pkgname_string; +} + +// Define Package for shared app classes from JAR file and also checks for +// package sealing (all done in Java code) +// See http://docs.oracle.com/javase/tutorial/deployment/jar/sealman.html +void SystemDictionaryShared::define_shared_package(Symbol* class_name, + Handle class_loader, + Handle manifest, + Handle url, + TRAPS) { + assert(class_loader == _java_system_loader, "unexpected class loader"); + // get_package_name() returns a NULL handle if the class is in unnamed package + Handle pkgname_string = get_package_name(class_name, CHECK); + if (pkgname_string.not_null()) { + Klass* app_classLoader_klass = SystemDictionary::jdk_internal_loader_ClassLoaders_AppClassLoader_klass(); + JavaValue result(T_OBJECT); + JavaCallArguments args(3); + args.set_receiver(class_loader); + args.push_oop(pkgname_string); + args.push_oop(manifest); + args.push_oop(url); + JavaCalls::call_virtual(&result, app_classLoader_klass, + vmSymbols::defineOrCheckPackage_name(), + vmSymbols::defineOrCheckPackage_signature(), + &args, + CHECK); + } +} + +// Define Package for shared app/platform classes from named module +void SystemDictionaryShared::define_shared_package(Symbol* class_name, + Handle class_loader, + ModuleEntry* mod_entry, + TRAPS) { + assert(mod_entry != NULL, "module_entry should not be NULL"); + Handle module_handle(THREAD, mod_entry->module()); + + Handle pkg_name = get_package_name(class_name, CHECK); + assert(pkg_name.not_null(), "Package should not be null for class in named module"); + + Klass* classLoader_klass; + if (SystemDictionary::is_system_class_loader(class_loader())) { + classLoader_klass = SystemDictionary::jdk_internal_loader_ClassLoaders_AppClassLoader_klass(); + } else { + assert(SystemDictionary::is_platform_class_loader(class_loader()), "unexpected classloader"); + classLoader_klass = SystemDictionary::jdk_internal_loader_ClassLoaders_PlatformClassLoader_klass(); + } + + JavaValue result(T_OBJECT); + JavaCallArguments args(2); + args.set_receiver(class_loader); + args.push_oop(pkg_name); + args.push_oop(module_handle); + JavaCalls::call_virtual(&result, classLoader_klass, + vmSymbols::definePackage_name(), + vmSymbols::definePackage_signature(), + &args, + CHECK); +} + +// Get the ProtectionDomain associated with the CodeSource from the classloader. +Handle SystemDictionaryShared::get_protection_domain_from_classloader(Handle class_loader, + Handle url, TRAPS) { + // CodeSource cs = new CodeSource(url, null); + InstanceKlass* cs_klass = SystemDictionary::CodeSource_klass(); + Handle cs = cs_klass->allocate_instance_handle(CHECK_NH); + JavaValue void_result(T_VOID); + JavaCalls::call_special(&void_result, cs, cs_klass, + vmSymbols::object_initializer_name(), + vmSymbols::url_code_signer_array_void_signature(), + url, Handle(), CHECK_NH); + + // protection_domain = SecureClassLoader.getProtectionDomain(cs); + Klass* secureClassLoader_klass = SystemDictionary::SecureClassLoader_klass(); + JavaValue obj_result(T_OBJECT); + JavaCalls::call_virtual(&obj_result, class_loader, secureClassLoader_klass, + vmSymbols::getProtectionDomain_name(), + vmSymbols::getProtectionDomain_signature(), + cs, CHECK_NH); + return Handle(THREAD, (oop)obj_result.get_jobject()); +} + +// Returns the ProtectionDomain associated with the JAR file identified by the url. +Handle SystemDictionaryShared::get_shared_protection_domain(Handle class_loader, + int shared_path_index, + Handle url, + TRAPS) { + Handle protection_domain; + if (shared_protection_domain(shared_path_index) == NULL) { + Handle pd = get_protection_domain_from_classloader(class_loader, url, THREAD); + atomic_set_shared_protection_domain(shared_path_index, pd()); + } + + // Acquire from the cache because if another thread beats the current one to + // set the shared protection_domain and the atomic_set fails, the current thread + // needs to get the updated protection_domain from the cache. + protection_domain = Handle(THREAD, shared_protection_domain(shared_path_index)); + assert(protection_domain.not_null(), "sanity"); + return protection_domain; +} + +// Returns the ProtectionDomain associated with the moduleEntry. +Handle SystemDictionaryShared::get_shared_protection_domain(Handle class_loader, + ModuleEntry* mod, TRAPS) { + ClassLoaderData *loader_data = mod->loader_data(); + Handle protection_domain; + if (mod->shared_protection_domain() == NULL) { + Symbol* location = mod->location(); + if (location != NULL) { + Handle url_string = java_lang_String::create_from_symbol( + location, CHECK_(protection_domain)); + JavaValue result(T_OBJECT); + Klass* classLoaders_klass = + SystemDictionary::jdk_internal_loader_ClassLoaders_klass(); + JavaCalls::call_static(&result, classLoaders_klass, vmSymbols::toFileURL_name(), + vmSymbols::toFileURL_signature(), + url_string, CHECK_(protection_domain)); + Handle url = Handle(THREAD, (oop)result.get_jobject()); + + Handle pd = get_protection_domain_from_classloader(class_loader, url, THREAD); + mod->set_shared_protection_domain(loader_data, pd); + } + } + + protection_domain = Handle(THREAD, mod->shared_protection_domain()); + assert(protection_domain.not_null(), "sanity"); + return protection_domain; +} + +// Initializes the java.lang.Package and java.security.ProtectionDomain objects associated with +// the given InstanceKlass. +// Returns the ProtectionDomain for the InstanceKlass. +Handle SystemDictionaryShared::init_security_info(Handle class_loader, InstanceKlass* ik, TRAPS) { + Handle pd; + + if (ik != NULL) { + int index = ik->shared_classpath_index(); + assert(index >= 0, "Sanity"); + SharedClassPathEntryExt* ent = + (SharedClassPathEntryExt*)FileMapInfo::shared_classpath(index); + Symbol* class_name = ik->name(); + + if (ent->is_modules_image()) { + // For shared app/platform classes originated from the run-time image: + // The ProtectionDomains are cached in the corresponding ModuleEntries + // for fast access by the VM. + ResourceMark rm; + ClassLoaderData *loader_data = + ClassLoaderData::class_loader_data(class_loader()); + PackageEntryTable* pkgEntryTable = loader_data->packages(); + TempNewSymbol pkg_name = InstanceKlass::package_from_name(class_name, CHECK_(pd)); + if (pkg_name != NULL) { + PackageEntry* pkg_entry = pkgEntryTable->lookup_only(pkg_name); + if (pkg_entry != NULL) { + ModuleEntry* mod_entry = pkg_entry->module(); + pd = get_shared_protection_domain(class_loader, mod_entry, THREAD); + define_shared_package(class_name, class_loader, mod_entry, CHECK_(pd)); + } + } + } else { + // For shared app/platform classes originated from JAR files on the class path: + // Each of the 3 SystemDictionaryShared::_shared_xxx arrays has the same length + // as the shared classpath table in the shared archive (see + // FileMap::_classpath_entry_table in filemap.hpp for details). + // + // If a shared InstanceKlass k is loaded from the class path, let + // + // index = k->shared_classpath_index(): + // + // FileMap::_classpath_entry_table[index] identifies the JAR file that contains k. + // + // k's protection domain is: + // + // ProtectionDomain pd = _shared_protection_domains[index]; + // + // and k's Package is initialized using + // + // manifest = _shared_jar_manifests[index]; + // url = _shared_jar_urls[index]; + // define_shared_package(class_name, class_loader, manifest, url, CHECK_(pd)); + // + // Note that if an element of these 3 _shared_xxx arrays is NULL, it will be initialized by + // the corresponding SystemDictionaryShared::get_shared_xxx() function. + Handle manifest = get_shared_jar_manifest(index, CHECK_(pd)); + Handle url = get_shared_jar_url(index, CHECK_(pd)); + define_shared_package(class_name, class_loader, manifest, url, CHECK_(pd)); + pd = get_shared_protection_domain(class_loader, index, url, CHECK_(pd)); + } + } + return pd; +} + +// Currently AppCDS only archives classes from the run-time image, the +// -Xbootclasspath/a path, and the class path. The following rules need to be +// revised when AppCDS is changed to archive classes from other code sources +// in the future, for example the module path (specified by -p). +// +// Check if a shared class can be loaded by the specific classloader. Following +// are the "visible" archived classes for different classloaders. +// +// NULL classloader: +// - see SystemDictionary::is_shared_class_visible() +// Platform classloader: +// - Module class from "modules" jimage. ModuleEntry must be defined in the +// classloader. +// App Classloader: +// - Module class from "modules" jimage. ModuleEntry must be defined in the +// classloader. +// - Class from -cp. The class must have no PackageEntry defined in any of the +// boot/platform/app classloader, or must be in the unnamed module defined in the +// AppClassLoader. +bool SystemDictionaryShared::is_shared_class_visible_for_classloader( + InstanceKlass* ik, + Handle class_loader, + const char* pkg_string, + Symbol* pkg_name, + PackageEntry* pkg_entry, + ModuleEntry* mod_entry, + TRAPS) { + assert(class_loader.not_null(), "Class loader should not be NULL"); + assert(Universe::is_module_initialized(), "Module system is not initialized"); + + int path_index = ik->shared_classpath_index(); + SharedClassPathEntry* ent = + (SharedClassPathEntry*)FileMapInfo::shared_classpath(path_index); + + if (SystemDictionary::is_platform_class_loader(class_loader())) { + assert(ent != NULL, "shared class for PlatformClassLoader should have valid SharedClassPathEntry"); + // The PlatformClassLoader can only load archived class originated from the + // run-time image. The class' PackageEntry/ModuleEntry must be + // defined by the PlatformClassLoader. + if (mod_entry != NULL) { + // PackageEntry/ModuleEntry is found in the classloader. Check if the + // ModuleEntry's location agrees with the archived class' origination. + if (ent->is_modules_image() && mod_entry->location()->starts_with("jrt:")) { + return true; // Module class from the "modules" jimage + } + } + } else if (SystemDictionary::is_system_class_loader(class_loader())) { + assert(ent != NULL, "shared class for system loader should have valid SharedClassPathEntry"); + if (pkg_string == NULL) { + // The archived class is in the unnamed package. Currently, the boot image + // does not contain any class in the unnamed package. + assert(!ent->is_modules_image(), "Class in the unnamed package must be from the classpath"); + if (path_index >= ClassLoaderExt::app_paths_start_index()) { + return true; + } + } else { + // Check if this is from a PackageEntry/ModuleEntry defined in the AppClassloader. + if (pkg_entry == NULL) { + // It's not guaranteed that the class is from the classpath if the + // PackageEntry cannot be found from the AppClassloader. Need to check + // the boot and platform classloader as well. + if (get_package_entry(pkg_name, ClassLoaderData::class_loader_data_or_null(SystemDictionary::java_platform_loader())) == NULL && + get_package_entry(pkg_name, ClassLoaderData::the_null_class_loader_data()) == NULL) { + // The PackageEntry is not defined in any of the boot/platform/app classloaders. + // The archived class must from -cp path and not from the run-time image. + if (!ent->is_modules_image() && path_index >= ClassLoaderExt::app_paths_start_index()) { + return true; + } + } + } else if (mod_entry != NULL) { + // The package/module is defined in the AppClassLoader. Currently we only + // support archiving application module class from the run-time image. + // Packages from the -cp path are in the unnamed_module. + if ((ent->is_modules_image() && mod_entry->location()->starts_with("jrt:")) || + (pkg_entry->in_unnamed_module() && path_index >= ClassLoaderExt::app_paths_start_index())) { + DEBUG_ONLY( \ + ClassLoaderData* loader_data = class_loader_data(class_loader); \ + if (pkg_entry->in_unnamed_module()) \ + assert(mod_entry == loader_data->unnamed_module(), "the unnamed module is not defined in the classloader");) + + return true; + } + } + } + } else { + // TEMP: if a shared class can be found by a custom loader, consider it visible now. + // FIXME: is this actually correct? + return true; + } + return false; +} + +// The following stack shows how this code is reached: +// +// [0] SystemDictionaryShared::find_or_load_shared_class() +// [1] JVM_FindLoadedClass +// [2] java.lang.ClassLoader.findLoadedClass0() +// [3] java.lang.ClassLoader.findLoadedClass() +// [4] java.lang.ClassLoader.loadClass() +// [5] jdk.internal.loader.ClassLoaders$AppClassLoader_klass.loadClass() +// +// Because AppCDS supports only the PlatformClassLoader and AppClassLoader, we make the following +// assumptions (based on the JDK 8.0 source code): +// +// [a] these two loaders use the default implementation of +// ClassLoader.loadClass(String name, boolean resolve), which +// [b] calls findLoadedClass(name), immediately followed by parent.loadClass(), +// immediately followed by findClass(name). +// [c] If the requested class is a shared class of the current class loader, parent.loadClass() +// always returns null, and +// [d] if AppCDS is not enabled, the class would be loaded by findClass() by decoding it from a +// JAR file and then parsed. +// +// Given these assumptions, we intercept the findLoadedClass() call to invoke +// SystemDictionaryShared::find_or_load_shared_class() to load the shared class from +// the archive. The reasons are: +// +// + Because AppCDS is a commercial feature, we want to hide the implementation. There +// is currently no easy way to hide Java code, so we did it with native code. +// + Start-up is improved because we avoid decoding the JAR file, and avoid delegating +// to the parent (since we know the parent will not find this class). +// +// NOTE: there's a lot of assumption about the Java code. If any of that change, this +// needs to be redesigned. +// +// An alternative is to modify the Java code of AppClassLoader.loadClass(). +// +InstanceKlass* SystemDictionaryShared::find_or_load_shared_class( + Symbol* name, Handle class_loader, TRAPS) { + if (DumpSharedSpaces) { + return NULL; + } + + InstanceKlass* k = NULL; + if (shared_dictionary() != NULL && + UseAppCDS && (SystemDictionary::is_system_class_loader(class_loader()) || + SystemDictionary::is_platform_class_loader(class_loader()))) { + + // Fix for 4474172; see evaluation for more details + class_loader = Handle( + THREAD, java_lang_ClassLoader::non_reflection_class_loader(class_loader())); + ClassLoaderData *loader_data = register_loader(class_loader, CHECK_NULL); + Dictionary* dictionary = loader_data->dictionary(); + + unsigned int d_hash = dictionary->compute_hash(name); + + bool DoObjectLock = true; + if (is_parallelCapable(class_loader)) { + DoObjectLock = false; + } + + // Make sure we are synchronized on the class loader before we proceed + // + // Note: currently, find_or_load_shared_class is called only from + // JVM_FindLoadedClass and used for PlatformClassLoader and AppClassLoader, + // which are parallel-capable loaders, so this lock is NOT taken. + Handle lockObject = compute_loader_lock_object(class_loader, THREAD); + check_loader_lock_contention(lockObject, THREAD); + ObjectLocker ol(lockObject, THREAD, DoObjectLock); + + { + MutexLocker mu(SystemDictionary_lock, THREAD); + Klass* check = find_class(d_hash, name, dictionary); + if (check != NULL) { + return InstanceKlass::cast(check); + } + } + + k = load_shared_class_for_builtin_loader(name, class_loader, THREAD); + if (k != NULL) { + define_instance_class(k, CHECK_NULL); + } + } + + return k; +} + +InstanceKlass* SystemDictionaryShared::load_shared_class_for_builtin_loader( + Symbol* class_name, Handle class_loader, TRAPS) { + assert(UseAppCDS && shared_dictionary() != NULL, "already checked"); + Klass* k = shared_dictionary()->find_class_for_builtin_loader(class_name); + + if (k != NULL) { + InstanceKlass* ik = InstanceKlass::cast(k); + if ((ik->is_shared_app_class() && + SystemDictionary::is_system_class_loader(class_loader())) || + (ik->is_shared_platform_class() && + SystemDictionary::is_platform_class_loader(class_loader()))) { + Handle protection_domain = + SystemDictionaryShared::init_security_info(class_loader, ik, CHECK_NULL); + return load_shared_class(ik, class_loader, protection_domain, THREAD); + } + } + + return NULL; +} + +void SystemDictionaryShared::oops_do(OopClosure* f) { + f->do_oop((oop*)&_shared_protection_domains); + f->do_oop((oop*)&_shared_jar_urls); + f->do_oop((oop*)&_shared_jar_manifests); +} + +void SystemDictionaryShared::allocate_shared_protection_domain_array(int size, TRAPS) { + if (_shared_protection_domains == NULL) { + _shared_protection_domains = oopFactory::new_objArray( + SystemDictionary::ProtectionDomain_klass(), size, CHECK); + } +} + +void SystemDictionaryShared::allocate_shared_jar_url_array(int size, TRAPS) { + if (_shared_jar_urls == NULL) { + _shared_jar_urls = oopFactory::new_objArray( + SystemDictionary::URL_klass(), size, CHECK); + } +} + +void SystemDictionaryShared::allocate_shared_jar_manifest_array(int size, TRAPS) { + if (_shared_jar_manifests == NULL) { + _shared_jar_manifests = oopFactory::new_objArray( + SystemDictionary::Jar_Manifest_klass(), size, CHECK); + } +} + +void SystemDictionaryShared::allocate_shared_data_arrays(int size, TRAPS) { + allocate_shared_protection_domain_array(size, CHECK); + allocate_shared_jar_url_array(size, CHECK); + allocate_shared_jar_manifest_array(size, CHECK); +} + + +InstanceKlass* SystemDictionaryShared::lookup_from_stream(const Symbol* class_name, + Handle class_loader, + Handle protection_domain, + const ClassFileStream* cfs, + TRAPS) { + if (!UseAppCDS || shared_dictionary() == NULL) { + return NULL; + } + if (class_name == NULL) { // don't do this for anonymous classes + return NULL; + } + if (class_loader.is_null() || + SystemDictionary::is_system_class_loader(class_loader()) || + SystemDictionary::is_platform_class_loader(class_loader())) { + // This function is called for loading only UNREGISTERED classes. + // Do nothing for the BUILTIN loaders. + return NULL; + } + + ClassLoaderData* loader_data = ClassLoaderData::class_loader_data(class_loader()); + Klass* k; + + { // UNREGISTERED loader + if (!shared_dictionary()->class_exists_for_unregistered_loader(class_name)) { + // No classes of this name for unregistered loaders. + return NULL; + } + + int clsfile_size = cfs->length(); + int clsfile_crc32 = ClassLoader::crc32(0, (const char*)cfs->buffer(), cfs->length()); + + k = shared_dictionary()->find_class_for_unregistered_loader(class_name, + clsfile_size, clsfile_crc32); + } + + if (k == NULL) { // not archived + return NULL; + } + + return acquire_class_for_current_thread(InstanceKlass::cast(k), class_loader, + protection_domain, THREAD); +} + +InstanceKlass* SystemDictionaryShared::acquire_class_for_current_thread( + InstanceKlass *ik, + Handle class_loader, + Handle protection_domain, + TRAPS) { + ClassLoaderData* loader_data = ClassLoaderData::class_loader_data(class_loader()); + + { + MutexLocker mu(SharedDictionary_lock, THREAD); + if (ik->class_loader_data() != NULL) { + // ik is already loaded (by this loader or by a different loader) + // or ik is being loaded by a different thread (by this loader or by a different loader) + return NULL; + } + + // No other thread has acquired this yet, so give it to *this thread* + ik->set_class_loader_data(loader_data); + } + + // No longer holding SharedDictionary_lock + // No need to lock, as can be held only by a single thread. + loader_data->add_class(ik); + + // Load and check super/interfaces, restore unsharable info + InstanceKlass* shared_klass = load_shared_class(ik, class_loader, protection_domain, THREAD); + if (shared_klass == NULL || HAS_PENDING_EXCEPTION) { + // TODO: clean up so it can be used again + return NULL; + } + + return shared_klass; +} + +bool SystemDictionaryShared::add_non_builtin_klass(Symbol* name, ClassLoaderData* loader_data, + InstanceKlass* k, + TRAPS) { + assert(DumpSharedSpaces, "only when dumping"); + assert(UseAppCDS && boot_loader_dictionary() != NULL, "must be"); + + if (boot_loader_dictionary()->add_non_builtin_klass(name, loader_data, k)) { + MutexLocker mu_r(Compile_lock, THREAD); // not really necessary, but add_to_hierarchy asserts this. + add_to_hierarchy(k, CHECK_0); + return true; + } + return false; +} + +// This function is called to resolve the super/interfaces of shared classes for +// non-built-in loaders. E.g., ChildClass in the below example +// where "super:" (and optionally "interface:") have been specified. +// +// java/lang/Object id: 0 +// Interface id: 2 super: 0 source: cust.jar +// ChildClass id: 4 super: 0 interfaces: 2 source: cust.jar +Klass* SystemDictionaryShared::dump_time_resolve_super_or_fail( + Symbol* child_name, Symbol* class_name, Handle class_loader, + Handle protection_domain, bool is_superclass, TRAPS) { + + assert(DumpSharedSpaces, "only when dumping"); + + ClassListParser* parser = ClassListParser::instance(); + if (parser == NULL) { + // We're still loading the well-known classes, before the ClassListParser is created. + return NULL; + } + if (child_name->equals(parser->current_class_name())) { + // When this function is called, all the numbered super and interface types + // must have already been loaded. Hence this function is never recursively called. + if (is_superclass) { + return parser->lookup_super_for_current_class(class_name); + } else { + return parser->lookup_interface_for_current_class(class_name); + } + } else { + // The VM is not trying to resolve a super type of parser->current_class_name(). + // Instead, it's resolving an error class (because parser->current_class_name() has + // failed parsing or verification). Don't do anything here. + return NULL; + } +} + +struct SharedMiscInfo { + Klass* _klass; + int _clsfile_size; + int _clsfile_crc32; +}; + +static GrowableArray* misc_info_array = NULL; + +void SystemDictionaryShared::set_shared_class_misc_info(Klass* k, ClassFileStream* cfs) { + assert(DumpSharedSpaces, "only when dumping"); + int clsfile_size = cfs->length(); + int clsfile_crc32 = ClassLoader::crc32(0, (const char*)cfs->buffer(), cfs->length()); + + if (misc_info_array == NULL) { + misc_info_array = new (ResourceObj::C_HEAP, mtClass) GrowableArray(20, /*c heap*/ true); + } + + SharedMiscInfo misc_info; + DEBUG_ONLY({ + for (int i=0; ilength(); i++) { + misc_info = misc_info_array->at(i); + assert(misc_info._klass != k, "cannot call set_shared_class_misc_info twice for the same class"); + } + }); + + misc_info._klass = k; + misc_info._clsfile_size = clsfile_size; + misc_info._clsfile_crc32 = clsfile_crc32; + + misc_info_array->append(misc_info); +} + +void SystemDictionaryShared::init_shared_dictionary_entry(Klass* k, DictionaryEntry* ent) { + SharedDictionaryEntry* entry = (SharedDictionaryEntry*)ent; + entry->_id = -1; + entry->_clsfile_size = -1; + entry->_clsfile_crc32 = -1; + entry->_verifier_constraints = NULL; + entry->_verifier_constraint_flags = NULL; + + if (misc_info_array != NULL) { + for (int i=0; ilength(); i++) { + SharedMiscInfo misc_info = misc_info_array->at(i); + if (misc_info._klass == k) { + entry->_clsfile_size = misc_info._clsfile_size; + entry->_clsfile_crc32 = misc_info._clsfile_crc32; + misc_info_array->remove_at(i); + return; + } + } + } +} + +bool SystemDictionaryShared::add_verification_constraint(Klass* k, Symbol* name, + Symbol* from_name, bool from_field_is_protected, bool from_is_array, bool from_is_object) { + assert(DumpSharedSpaces, "called at dump time only"); + + // Skip anonymous classes, which are not archived as they are not in + // dictionary (see assert_no_anonymoys_classes_in_dictionaries() in + // VM_PopulateDumpSharedSpace::doit()). + if (k->class_loader_data()->is_anonymous()) { + return true; // anonymous classes are not archived, skip + } + + SharedDictionaryEntry* entry = ((SharedDictionary*)(k->class_loader_data()->dictionary()))->find_entry_for(k); + ResourceMark rm; + // Lambda classes are not archived and will be regenerated at runtime. + if (entry == NULL && strstr(k->name()->as_C_string(), "Lambda$") != NULL) { + return true; + } + assert(entry != NULL, "class should be in dictionary before being verified"); + entry->add_verification_constraint(name, from_name, from_field_is_protected, + from_is_array, from_is_object); + if (entry->is_builtin()) { + // For builtin class loaders, we can try to complete the verification check at dump time, + // because we can resolve all the constraint classes. + return false; + } else { + // For non-builtin class loaders, we cannot complete the verification check at dump time, + // because at dump time we don't know how to resolve classes for such loaders. + return true; + } +} + +void SystemDictionaryShared::finalize_verification_constraints() { + boot_loader_dictionary()->finalize_verification_constraints(); +} + +void SystemDictionaryShared::check_verification_constraints(InstanceKlass* klass, + TRAPS) { + assert(!DumpSharedSpaces && UseSharedSpaces, "called at run time with CDS enabled only"); + SharedDictionaryEntry* entry = shared_dictionary()->find_entry_for(klass); + assert(entry != NULL, "call this only for shared classes"); + entry->check_verification_constraints(klass, THREAD); +} + +SharedDictionaryEntry* SharedDictionary::find_entry_for(Klass* klass) { + Symbol* class_name = klass->name(); + unsigned int hash = compute_hash(class_name); + int index = hash_to_index(hash); + + for (SharedDictionaryEntry* entry = bucket(index); + entry != NULL; + entry = entry->next()) { + if (entry->hash() == hash && entry->literal() == klass) { + return entry; + } + } + + return NULL; +} + +void SharedDictionary::finalize_verification_constraints() { + int bytes = 0, count = 0; + for (int index = 0; index < table_size(); index++) { + for (SharedDictionaryEntry *probe = bucket(index); + probe != NULL; + probe = probe->next()) { + int n = probe->finalize_verification_constraints(); + if (n > 0) { + bytes += n; + count ++; + } + } + } + if (log_is_enabled(Info, cds, verification)) { + double avg = 0; + if (count > 0) { + avg = double(bytes) / double(count); + } + log_info(cds, verification)("Recorded verification constraints for %d classes = %d bytes (avg = %.2f bytes) ", count, bytes, avg); + } +} + +void SharedDictionaryEntry::add_verification_constraint(Symbol* name, + Symbol* from_name, bool from_field_is_protected, bool from_is_array, bool from_is_object) { + if (_verifier_constraints == NULL) { + _verifier_constraints = new(ResourceObj::C_HEAP, mtClass) GrowableArray(8, true, mtClass); + } + if (_verifier_constraint_flags == NULL) { + _verifier_constraint_flags = new(ResourceObj::C_HEAP, mtClass) GrowableArray(4, true, mtClass); + } + GrowableArray* vc_array = (GrowableArray*)_verifier_constraints; + for (int i=0; ilength(); i+= 2) { + if (name == vc_array->at(i) && + from_name == vc_array->at(i+1)) { + return; + } + } + vc_array->append(name); + vc_array->append(from_name); + + GrowableArray* vcflags_array = (GrowableArray*)_verifier_constraint_flags; + char c = 0; + c |= from_field_is_protected ? FROM_FIELD_IS_PROTECTED : 0; + c |= from_is_array ? FROM_IS_ARRAY : 0; + c |= from_is_object ? FROM_IS_OBJECT : 0; + vcflags_array->append(c); + + if (log_is_enabled(Trace, cds, verification)) { + ResourceMark rm; + log_trace(cds, verification)("add_verification_constraint: %s: %s must be subclass of %s", + instance_klass()->external_name(), from_name->as_klass_external_name(), + name->as_klass_external_name()); + } +} + +int SharedDictionaryEntry::finalize_verification_constraints() { + assert(DumpSharedSpaces, "called at dump time only"); + Thread* THREAD = Thread::current(); + ClassLoaderData* loader_data = ClassLoaderData::the_null_class_loader_data(); + GrowableArray* vc_array = (GrowableArray*)_verifier_constraints; + GrowableArray* vcflags_array = (GrowableArray*)_verifier_constraint_flags; + + if (vc_array != NULL) { + if (log_is_enabled(Trace, cds, verification)) { + ResourceMark rm; + log_trace(cds, verification)("finalize_verification_constraint: %s", + literal()->external_name()); + } + + // Copy the constraints from C_HEAP-alloced GrowableArrays to Metaspace-alloced + // Arrays + int size = 0; + { + // FIXME: change this to be done after relocation, so we can use symbol offset?? + int length = vc_array->length(); + Array* out = MetadataFactory::new_array(loader_data, length, 0, THREAD); + assert(out != NULL, "Dump time allocation failure would have aborted VM"); + for (int i=0; iat_put(i, vc_array->at(i)); + } + _verifier_constraints = out; + size += out->size() * BytesPerWord; + delete vc_array; + } + { + int length = vcflags_array->length(); + Array* out = MetadataFactory::new_array(loader_data, length, 0, THREAD); + assert(out != NULL, "Dump time allocation failure would have aborted VM"); + for (int i=0; iat_put(i, vcflags_array->at(i)); + } + _verifier_constraint_flags = out; + size += out->size() * BytesPerWord; + delete vcflags_array; + } + + return size; + } + return 0; +} + +void SharedDictionaryEntry::check_verification_constraints(InstanceKlass* klass, TRAPS) { + Array* vc_array = (Array*)_verifier_constraints; + Array* vcflags_array = (Array*)_verifier_constraint_flags; + + if (vc_array != NULL) { + int length = vc_array->length(); + for (int i=0; iat(i); + Symbol* from_name = vc_array->at(i+1); + char c = vcflags_array->at(i/2); + + bool from_field_is_protected = (c & FROM_FIELD_IS_PROTECTED) ? true : false; + bool from_is_array = (c & FROM_IS_ARRAY) ? true : false; + bool from_is_object = (c & FROM_IS_OBJECT) ? true : false; + + bool ok = VerificationType::resolve_and_check_assignability(klass, name, + from_name, from_field_is_protected, from_is_array, from_is_object, CHECK); + if (!ok) { + ResourceMark rm(THREAD); + stringStream ss; + + ss.print_cr("Bad type on operand stack"); + ss.print_cr("Exception Details:"); + ss.print_cr(" Location:\n %s", klass->name()->as_C_string()); + ss.print_cr(" Reason:\n Type '%s' is not assignable to '%s'", + from_name->as_quoted_ascii(), name->as_quoted_ascii()); + THROW_MSG(vmSymbols::java_lang_VerifyError(), ss.as_string()); + } + } + } +} + +void SharedDictionaryEntry::metaspace_pointers_do(MetaspaceClosure* it) { + it->push((Array**)&_verifier_constraints); + it->push((Array**)&_verifier_constraint_flags); +} + +bool SharedDictionary::add_non_builtin_klass(const Symbol* class_name, + ClassLoaderData* loader_data, + InstanceKlass* klass) { + + assert(DumpSharedSpaces, "supported only when dumping"); + assert(klass != NULL, "adding NULL klass"); + assert(klass->name() == class_name, "sanity check on name"); + assert(klass->shared_classpath_index() < 0, + "the shared classpath index should not be set for shared class loaded by the custom loaders"); + + // Add an entry for a non-builtin class. + // For a shared class for custom class loaders, SystemDictionary::resolve_or_null will + // not find this class, because is_builtin() is false. + unsigned int hash = compute_hash(class_name); + int index = hash_to_index(hash); + + for (SharedDictionaryEntry* entry = bucket(index); + entry != NULL; + entry = entry->next()) { + if (entry->hash() == hash) { + Klass* klass = (Klass*)entry->literal(); + if (klass->name() == class_name && klass->class_loader_data() == loader_data) { + // There is already a class defined with the same name + return false; + } + } + } + + assert(Dictionary::entry_size() >= sizeof(SharedDictionaryEntry), "must be big enough"); + SharedDictionaryEntry* entry = (SharedDictionaryEntry*)new_entry(hash, klass); + add_entry(index, entry); + + assert(entry->is_unregistered(), "sanity"); + assert(!entry->is_builtin(), "sanity"); + return true; +} + + +//----------------- +// SharedDictionary +//----------------- + + +Klass* SharedDictionary::find_class_for_builtin_loader(const Symbol* name) const { + SharedDictionaryEntry* entry = get_entry_for_builtin_loader(name); + return entry != NULL ? entry->instance_klass() : (Klass*)NULL; +} + +Klass* SharedDictionary::find_class_for_unregistered_loader(const Symbol* name, + int clsfile_size, + int clsfile_crc32) const { + + const SharedDictionaryEntry* entry = get_entry_for_unregistered_loader(name, + clsfile_size, + clsfile_crc32); + return entry != NULL ? entry->instance_klass() : (Klass*)NULL; +} + +void SharedDictionary::update_entry(Klass* klass, int id) { + assert(DumpSharedSpaces, "supported only when dumping"); + Symbol* class_name = klass->name(); + unsigned int hash = compute_hash(class_name); + int index = hash_to_index(hash); + + for (SharedDictionaryEntry* entry = bucket(index); + entry != NULL; + entry = entry->next()) { + if (entry->hash() == hash && entry->literal() == klass) { + entry->_id = id; + return; + } + } + + ShouldNotReachHere(); +} + +SharedDictionaryEntry* SharedDictionary::get_entry_for_builtin_loader(const Symbol* class_name) const { + assert(!DumpSharedSpaces, "supported only when at runtime"); + unsigned int hash = compute_hash(class_name); + const int index = hash_to_index(hash); + + for (SharedDictionaryEntry* entry = bucket(index); + entry != NULL; + entry = entry->next()) { + if (entry->hash() == hash && entry->equals(class_name)) { + if (entry->is_builtin()) { + return entry; + } + } + } + return NULL; +} + +SharedDictionaryEntry* SharedDictionary::get_entry_for_unregistered_loader(const Symbol* class_name, + int clsfile_size, + int clsfile_crc32) const { + assert(!DumpSharedSpaces, "supported only when at runtime"); + unsigned int hash = compute_hash(class_name); + int index = hash_to_index(hash); + + for (SharedDictionaryEntry* entry = bucket(index); + entry != NULL; + entry = entry->next()) { + if (entry->hash() == hash && entry->equals(class_name)) { + if (entry->is_unregistered()) { + if (clsfile_size == -1) { + // We're called from class_exists_for_unregistered_loader. At run time, we want to + // compute the CRC of a ClassFileStream only if there is an UNREGISTERED class + // with the matching name. + return entry; + } else { + // We're called from find_class_for_unregistered_loader + if (entry->_clsfile_size && clsfile_crc32 == entry->_clsfile_crc32) { + return entry; + } + } + + // There can be only 1 class with this name for unregistered loaders. + return NULL; + } + } + } + return NULL; +} diff --git a/src/hotspot/share/classfile/systemDictionaryShared.hpp b/src/hotspot/share/classfile/systemDictionaryShared.hpp index 244e98e5d74..c1b87348a5a 100644 --- a/src/hotspot/share/classfile/systemDictionaryShared.hpp +++ b/src/hotspot/share/classfile/systemDictionaryShared.hpp @@ -25,75 +25,362 @@ #ifndef SHARE_VM_CLASSFILE_SYSTEMDICTIONARYSHARED_HPP #define SHARE_VM_CLASSFILE_SYSTEMDICTIONARYSHARED_HPP -#include "classfile/systemDictionary.hpp" +#include "oops/klass.hpp" #include "classfile/dictionary.hpp" +#include "classfile/systemDictionary.hpp" +#include "memory/filemap.hpp" + + +/*=============================================================================== + + Handling of the classes in the AppCDS archive + + To ensure safety and to simplify the implementation, archived classes are + "segregated" into several types. The following rules describe how they + are stored and looked up. + +[1] Category of archived classes + + There are 3 disjoint groups of classes stored in the AppCDS archive. They are + categorized as by their SharedDictionaryEntry::loader_type() + + BUILTIN: These classes may be defined ONLY by the BOOT/PLATFORM/APP + loaders. + + UNREGISTERED: These classes may be defined ONLY by a ClassLoader + instance that's not listed above (using fingerprint matching) + +[2] How classes from different categories are specified in the classlist: + + Starting from JDK9, each class in the classlist may be specified with + these keywords: "id", "super", "interfaces", "loader" and "source". + + + BUILTIN Only the "id" keyword may be (optionally) specified. All other + keywords are forbidden. + + The named class is looked up from the jimage and from + Xbootclasspath/a and CLASSPATH. + + UNREGISTERED: The "id", "super", and "source" keywords must all be + specified. + + The "interfaces" keyword must be specified if the class implements + one or more local interfaces. The "interfaces" keyword must not be + specified if the class does not implement local interfaces. + + The named class is looked up from the location specified in the + "source" keyword. + + Example classlist: + + # BUILTIN + java/lang/Object id: 0 + java/lang/Cloneable id: 1 + java/lang/String + + # UNREGISTERED + Bar id: 3 super: 0 interfaces: 1 source: /foo.jar + + +[3] Identifying the loader_type of archived classes in the shared dictionary + + Each archived Klass* C is associated with a SharedDictionaryEntry* E + + BUILTIN: (C->shared_classpath_index() >= 0) + UNREGISTERED: (C->shared_classpath_index() < 0) + +[4] Lookup of archived classes at run time: + + (a) BUILTIN loaders: + + Search the shared directory for a BUILTIN class with a matching name. + + (b) UNREGISTERED loaders: + + The search originates with SystemDictionaryShared::lookup_from_stream(). + + Search the shared directory for a UNREGISTERED class with a matching + (name, clsfile_len, clsfile_crc32) tuple. + +===============================================================================*/ +#define UNREGISTERED_INDEX -9999 class ClassFileStream; -class SystemDictionaryShared: public SystemDictionary { +// Archived classes need extra information not needed by traditionally loaded classes. +// To keep footprint small, we add these in the dictionary entry instead of the InstanceKlass. +class SharedDictionaryEntry : public DictionaryEntry { + public: - static void initialize(TRAPS) {} - static InstanceKlass* find_or_load_shared_class(Symbol* class_name, - Handle class_loader, - TRAPS) { - return NULL; - } - static void roots_oops_do(OopClosure* blk) {} - static void oops_do(OopClosure* f) {} - static bool is_sharing_possible(ClassLoaderData* loader_data) { - oop class_loader = loader_data->class_loader(); - return (class_loader == NULL); - } - static bool is_shared_class_visible_for_classloader( - InstanceKlass* ik, - Handle class_loader, - const char* pkg_string, - Symbol* pkg_name, - PackageEntry* pkg_entry, - ModuleEntry* mod_entry, - TRAPS) { - return false; + enum LoaderType { + LT_BUILTIN, + LT_UNREGISTERED + }; + + enum { + FROM_FIELD_IS_PROTECTED = 1 << 0, + FROM_IS_ARRAY = 1 << 1, + FROM_IS_OBJECT = 1 << 2 + }; + + int _id; + int _clsfile_size; + int _clsfile_crc32; + void* _verifier_constraints; // FIXME - use a union here to avoid type casting?? + void* _verifier_constraint_flags; + + // See "Identifying the loader_type of archived classes" comments above. + LoaderType loader_type() const { + Klass* k = (Klass*)literal(); + + if ((k->shared_classpath_index() != UNREGISTERED_INDEX)) { + return LT_BUILTIN; + } else { + return LT_UNREGISTERED; + } } + SharedDictionaryEntry* next() { + return (SharedDictionaryEntry*)(DictionaryEntry::next()); + } + + bool is_builtin() const { + return loader_type() == LT_BUILTIN; + } + bool is_unregistered() const { + return loader_type() == LT_UNREGISTERED; + } + + void add_verification_constraint(Symbol* name, + Symbol* from_name, bool from_field_is_protected, bool from_is_array, bool from_is_object); + int finalize_verification_constraints(); + void check_verification_constraints(InstanceKlass* klass, TRAPS); + void metaspace_pointers_do(MetaspaceClosure* it) NOT_CDS_RETURN; +}; + +class SharedDictionary : public Dictionary { + SharedDictionaryEntry* get_entry_for_builtin_loader(const Symbol* name) const; + SharedDictionaryEntry* get_entry_for_unregistered_loader(const Symbol* name, + int clsfile_size, + int clsfile_crc32) const; + + // Convenience functions + SharedDictionaryEntry* bucket(int index) const { + return (SharedDictionaryEntry*)(Dictionary::bucket(index)); + } + +public: + SharedDictionaryEntry* find_entry_for(Klass* klass); + void finalize_verification_constraints(); + + bool add_non_builtin_klass(const Symbol* class_name, + ClassLoaderData* loader_data, + InstanceKlass* obj); + + void update_entry(Klass* klass, int id); + + Klass* find_class_for_builtin_loader(const Symbol* name) const; + Klass* find_class_for_unregistered_loader(const Symbol* name, + int clsfile_size, + int clsfile_crc32) const; + bool class_exists_for_unregistered_loader(const Symbol* name) { + return (get_entry_for_unregistered_loader(name, -1, -1) != NULL); + } +}; + +class SystemDictionaryShared: public SystemDictionary { +private: + // These _shared_xxxs arrays are used to initialize the java.lang.Package and + // java.security.ProtectionDomain objects associated with each shared class. + // + // See SystemDictionaryShared::init_security_info for more info. + static objArrayOop _shared_protection_domains; + static objArrayOop _shared_jar_urls; + static objArrayOop _shared_jar_manifests; + + static InstanceKlass* load_shared_class_for_builtin_loader( + Symbol* class_name, + Handle class_loader, + TRAPS); + static Handle get_package_name(Symbol* class_name, TRAPS); + + + // Package handling: + // + // 1. For named modules in the runtime image + // BOOT classes: Reuses the existing JVM_GetSystemPackage(s) interfaces + // to get packages in named modules for shared classes. + // Package for non-shared classes in named module is also + // handled using JVM_GetSystemPackage(s). + // + // APP classes: VM calls ClassLoaders.AppClassLoader::definePackage(String, Module) + // to define package for shared app classes from named + // modules. + // + // PLATFORM classes: VM calls ClassLoaders.PlatformClassLoader::definePackage(String, Module) + // to define package for shared platform classes from named + // modules. + // + // 2. For unnamed modules + // BOOT classes: Reuses the existing JVM_GetSystemPackage(s) interfaces to + // get packages for shared boot classes in unnamed modules. + // + // APP classes: VM calls ClassLoaders.AppClassLoader::defineOrCheckPackage() + // with with the manifest and url from archived data. + // + // PLATFORM classes: No package is defined. + // + // The following two define_shared_package() functions are used to define + // package for shared APP and PLATFORM classes. + static void define_shared_package(Symbol* class_name, + Handle class_loader, + Handle manifest, + Handle url, + TRAPS); + static void define_shared_package(Symbol* class_name, + Handle class_loader, + ModuleEntry* mod_entry, + TRAPS); + + static Handle get_shared_jar_manifest(int shared_path_index, TRAPS); + static Handle get_shared_jar_url(int shared_path_index, TRAPS); + static Handle get_protection_domain_from_classloader(Handle class_loader, + Handle url, TRAPS); + static Handle get_shared_protection_domain(Handle class_loader, + int shared_path_index, + Handle url, + TRAPS); + static Handle get_shared_protection_domain(Handle class_loader, + ModuleEntry* mod, TRAPS); + static Handle init_security_info(Handle class_loader, InstanceKlass* ik, TRAPS); + + static void atomic_set_array_index(objArrayOop array, int index, oop o) { + // Benign race condition: array.obj_at(index) may already be filled in. + // The important thing here is that all threads pick up the same result. + // It doesn't matter which racing thread wins, as long as only one + // result is used by all threads, and all future queries. + array->atomic_compare_exchange_oop(index, o, NULL); + } + + static oop shared_protection_domain(int index); + static void atomic_set_shared_protection_domain(int index, oop pd) { + atomic_set_array_index(_shared_protection_domains, index, pd); + } + static void allocate_shared_protection_domain_array(int size, TRAPS); + static oop shared_jar_url(int index); + static void atomic_set_shared_jar_url(int index, oop url) { + atomic_set_array_index(_shared_jar_urls, index, url); + } + static void allocate_shared_jar_url_array(int size, TRAPS); + static oop shared_jar_manifest(int index); + static void atomic_set_shared_jar_manifest(int index, oop man) { + atomic_set_array_index(_shared_jar_manifests, index, man); + } + static void allocate_shared_jar_manifest_array(int size, TRAPS); + static InstanceKlass* acquire_class_for_current_thread( + InstanceKlass *ik, + Handle class_loader, + Handle protection_domain, + TRAPS); + +public: + static void initialize(TRAPS); + + // Called by PLATFORM/APP loader only + static InstanceKlass* find_or_load_shared_class(Symbol* class_name, + Handle class_loader, + TRAPS); + + + static void allocate_shared_data_arrays(int size, TRAPS); + static void oops_do(OopClosure* f); + static void roots_oops_do(OopClosure* f) { + oops_do(f); + } + + // Check if sharing is supported for the class loader. + static bool is_sharing_possible(ClassLoaderData* loader_data) { + oop class_loader = loader_data->class_loader(); + return (class_loader == NULL || + (UseAppCDS && (SystemDictionary::is_system_class_loader(class_loader) || + SystemDictionary::is_platform_class_loader(class_loader))) + ); + } + static bool is_shared_class_visible_for_classloader(InstanceKlass* ik, + Handle class_loader, + const char* pkg_string, + Symbol* pkg_name, + PackageEntry* pkg_entry, + ModuleEntry* mod_entry, + TRAPS); + static PackageEntry* get_package_entry(Symbol* pkg, + ClassLoaderData *loader_data) { + if (loader_data != NULL) { + PackageEntryTable* pkgEntryTable = loader_data->packages(); + return pkgEntryTable->lookup_only(pkg); + } + return NULL; + } + + static bool add_non_builtin_klass(Symbol* class_name, ClassLoaderData* loader_data, + InstanceKlass* k, TRAPS); static Klass* dump_time_resolve_super_or_fail(Symbol* child_name, Symbol* class_name, Handle class_loader, Handle protection_domain, bool is_superclass, - TRAPS) { - return NULL; - } + TRAPS); static size_t dictionary_entry_size() { - return sizeof(DictionaryEntry); + return (DumpSharedSpaces) ? sizeof(SharedDictionaryEntry) : sizeof(DictionaryEntry); + } + static void init_shared_dictionary_entry(Klass* k, DictionaryEntry* entry) NOT_CDS_RETURN; + static bool is_builtin(DictionaryEntry* ent) { + // Can't use virtual function is_builtin because DictionaryEntry doesn't initialize + // vtable because it's not constructed properly. + SharedDictionaryEntry* entry = (SharedDictionaryEntry*)ent; + return entry->is_builtin(); } - static void init_shared_dictionary_entry(Klass* k, DictionaryEntry* entry) {} - static bool is_builtin(DictionaryEntry* entry) { return true; } + // For convenient access to the SharedDictionaryEntry's of the archived classes. + static SharedDictionary* shared_dictionary() { + assert(!DumpSharedSpaces, "not for dumping"); + return (SharedDictionary*)SystemDictionary::shared_dictionary(); + } - static InstanceKlass* lookup_from_stream(Symbol* class_name, + static SharedDictionary* boot_loader_dictionary() { + return (SharedDictionary*)ClassLoaderData::the_null_class_loader_data()->dictionary(); + } + + static void update_shared_entry(Klass* klass, int id) { + assert(DumpSharedSpaces, "sanity"); + assert((SharedDictionary*)(klass->class_loader_data()->dictionary()) != NULL, "sanity"); + ((SharedDictionary*)(klass->class_loader_data()->dictionary()))->update_entry(klass, id); + } + + static void set_shared_class_misc_info(Klass* k, ClassFileStream* cfs); + + static InstanceKlass* lookup_from_stream(const Symbol* class_name, Handle class_loader, Handle protection_domain, const ClassFileStream* st, - TRAPS) { - return NULL; - } - - // The (non-application) CDS implementation supports only classes in the boot - // class loader, which ensures that the verification constraints are the same - // during archive creation time and runtime. Thus we can do the constraint checks - // entirely during archive creation time. + TRAPS); + // "verification_constraints" are a set of checks performed by + // VerificationType::is_reference_assignable_from when verifying a shared class during + // dump time. + // + // With AppCDS, it is possible to override archived classes by calling + // ClassLoader.defineClass() directly. SystemDictionary::load_shared_class() already + // ensures that you cannot load a shared class if its super type(s) are changed. However, + // we need an additional check to ensure that the verification_constraints did not change + // between dump time and runtime. static bool add_verification_constraint(Klass* k, Symbol* name, Symbol* from_name, bool from_field_is_protected, - bool from_is_array, bool from_is_object) {return false;} - static void finalize_verification_constraints() {} + bool from_is_array, bool from_is_object) NOT_CDS_RETURN_(false); + static void finalize_verification_constraints() NOT_CDS_RETURN; static void check_verification_constraints(InstanceKlass* klass, - TRAPS) {} -}; - -class SharedDictionaryEntry : public DictionaryEntry { -public: - void metaspace_pointers_do(MetaspaceClosure* it) {} + TRAPS) NOT_CDS_RETURN; }; #endif // SHARE_VM_CLASSFILE_SYSTEMDICTIONARYSHARED_HPP diff --git a/src/hotspot/share/classfile/systemDictionary_ext.hpp b/src/hotspot/share/classfile/systemDictionary_ext.hpp index 698805b657d..6d257cd09e9 100644 --- a/src/hotspot/share/classfile/systemDictionary_ext.hpp +++ b/src/hotspot/share/classfile/systemDictionary_ext.hpp @@ -1,5 +1,5 @@ /* - * Copyright (c) 2015, Oracle and/or its affiliates. All rights reserved. + * Copyright (c) 2015, 2017 Oracle and/or its affiliates. All rights reserved. * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. * * This code is free software; you can redistribute it and/or modify it @@ -25,6 +25,17 @@ #ifndef SHARE_VM_CLASSFILE_SYSTEMDICTIONARY_EXT_HPP #define SHARE_VM_CLASSFILE_SYSTEMDICTIONARY_EXT_HPP +#if INCLUDE_CDS + +#define WK_KLASSES_DO_EXT(do_klass) \ + /* well-known classes */ \ + do_klass(jdk_internal_loader_ClassLoaders_klass, jdk_internal_loader_ClassLoaders, Pre ) \ + /*end*/ + +#else + #define WK_KLASSES_DO_EXT(do_klass) +#endif // INCLUDE_CDS + #endif // SHARE_VM_CLASSFILE_SYSTEMDICTIONARY_EXT_HPP diff --git a/src/hotspot/share/classfile/vmSymbols.hpp b/src/hotspot/share/classfile/vmSymbols.hpp index 73fb9296772..65246e04bae 100644 --- a/src/hotspot/share/classfile/vmSymbols.hpp +++ b/src/hotspot/share/classfile/vmSymbols.hpp @@ -26,7 +26,6 @@ #define SHARE_VM_CLASSFILE_VMSYMBOLS_HPP #include "classfile/moduleEntry.hpp" -#include "classfile/vmSymbols_ext.hpp" #include "oops/symbol.hpp" #include "memory/iterator.hpp" #include "trace/traceMacros.hpp" @@ -673,8 +672,12 @@ /* trace signatures */ \ TRACE_TEMPLATES(template) \ \ - /* extensions */ \ - VM_SYMBOLS_DO_EXT(template, do_alias) \ + /* cds */ \ + template(jdk_internal_loader_ClassLoaders, "jdk/internal/loader/ClassLoaders") \ + template(jdk_vm_cds_SharedClassInfo, "jdk/vm/cds/SharedClassInfo") \ + template(url_void_signature, "(Ljava/net/URL;)V") \ + template(toFileURL_name, "toFileURL") \ + template(toFileURL_signature, "(Ljava/lang/String;)Ljava/net/URL;") \ \ /*end*/ diff --git a/src/hotspot/share/prims/cdsoffsets.cpp b/src/hotspot/share/prims/cdsoffsets.cpp new file mode 100644 index 00000000000..d38b7efbfff --- /dev/null +++ b/src/hotspot/share/prims/cdsoffsets.cpp @@ -0,0 +1,69 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +#include "precompiled.hpp" +#include "utilities/macros.hpp" +#if INCLUDE_CDS +#include "runtime/os.hpp" +#include "memory/filemap.hpp" +#include "memory/allocation.hpp" +#include "memory/allocation.inline.hpp" +#include "prims/cdsoffsets.hpp" + +CDSOffsets* CDSOffsets::_all = NULL; +#define ADD_NEXT(list, name, value) \ + list->add_end(new CDSOffsets(name, value, NULL)) + +#define CREATE_OFFSET_MAPS \ + _all = new CDSOffsets("size_t_size", sizeof(size_t), NULL); \ + ADD_NEXT(_all, "FileMapHeader::_magic", offset_of(FileMapInfo::FileMapHeader, _magic)); \ + ADD_NEXT(_all, "FileMapHeader::_crc", offset_of(FileMapInfo::FileMapHeader, _crc)); \ + ADD_NEXT(_all, "FileMapHeader::_version", offset_of(FileMapInfo::FileMapHeader, _version)); \ + ADD_NEXT(_all, "FileMapHeader::_space[0]", offset_of(FileMapInfo::FileMapHeader, _space)); \ + ADD_NEXT(_all, "space_info::_crc", offset_of(FileMapInfo::FileMapHeader::space_info, _crc)); \ + ADD_NEXT(_all, "space_info::_used", offset_of(FileMapInfo::FileMapHeader::space_info, _used)); \ + ADD_NEXT(_all, "FileMapHeader::_paths_misc_info_size", offset_of(FileMapInfo::FileMapHeader, _paths_misc_info_size)); \ + ADD_NEXT(_all, "file_header_size", sizeof(FileMapInfo::FileMapHeader)); \ + ADD_NEXT(_all, "space_info_size", sizeof(FileMapInfo::FileMapHeader::space_info)); + +int CDSOffsets::find_offset(const char* name) { + if (_all == NULL) { + CREATE_OFFSET_MAPS + } + CDSOffsets* it = _all; + while(it) { + if (!strcmp(name, it->get_name())) { + return it->get_offset(); + } + it = it->next(); + } + return -1; // not found +} + +void CDSOffsets::add_end(CDSOffsets* n) { + CDSOffsets* p = this; + while(p && p->_next) { p = p->_next; } + p->_next = n; +} +#endif // INCLUDE_CDS diff --git a/src/hotspot/share/prims/cdsoffsets.hpp b/src/hotspot/share/prims/cdsoffsets.hpp new file mode 100644 index 00000000000..aa147cc70a0 --- /dev/null +++ b/src/hotspot/share/prims/cdsoffsets.hpp @@ -0,0 +1,48 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +#ifndef SHARE_PRIMS_CDSOFFSETS_HPP +#define SHARE_PRIMS_CDSOFFSETS_HPP +class CDSOffsets: public CHeapObj { + private: + char* _name; + int _offset; + CDSOffsets* _next; + static CDSOffsets* _all; // sole list for cds + public: + CDSOffsets(const char* name, int offset, CDSOffsets* next) { + _name = NEW_C_HEAP_ARRAY(char, strlen(name) + 1, mtInternal); + strcpy(_name, name); + _offset = offset; + _next = next; + } + + char* get_name() const { return _name; } + int get_offset() const { return _offset; } + CDSOffsets* next() const { return _next; } + void add_end(CDSOffsets* n); + + static int find_offset(const char* name); +}; +#endif // SHARE_PRIMS_CDSOFFSETS_HPP diff --git a/src/hotspot/share/prims/whitebox.cpp b/src/hotspot/share/prims/whitebox.cpp index dd3e52d2012..28d8851ff08 100644 --- a/src/hotspot/share/prims/whitebox.cpp +++ b/src/hotspot/share/prims/whitebox.cpp @@ -61,6 +61,9 @@ #include "utilities/debug.hpp" #include "utilities/exceptions.hpp" #include "utilities/macros.hpp" +#if INCLUDE_CDS +#include "prims/cdsoffsets.hpp" +#endif // INCLUDE_CDS #if INCLUDE_ALL_GCS #include "gc/g1/concurrentMarkThread.hpp" #include "gc/g1/g1CollectedHeap.inline.hpp" @@ -1730,6 +1733,18 @@ WB_ENTRY(jboolean, WB_IsCDSIncludedInVmBuild(JNIEnv* env)) #endif WB_END + +#if INCLUDE_CDS + +WB_ENTRY(jint, WB_GetOffsetForName(JNIEnv* env, jobject o, jstring name)) + ResourceMark rm; + char* c_name = java_lang_String::as_utf8_string(JNIHandles::resolve_non_null(name)); + int result = CDSOffsets::find_offset(c_name); + return (jint)result; +WB_END + +#endif // INCLUDE_CDS + WB_ENTRY(jint, WB_HandshakeWalkStack(JNIEnv* env, jobject wb, jobject thread_handle, jboolean all_threads)) class TraceSelfClosure : public ThreadClosure { jint _num_threads_completed; @@ -1918,6 +1933,9 @@ static JNINativeMethod methods[] = { {CC"runMemoryUnitTests", CC"()V", (void*)&WB_RunMemoryUnitTests}, {CC"readFromNoaccessArea",CC"()V", (void*)&WB_ReadFromNoaccessArea}, {CC"stressVirtualSpaceResize",CC"(JJJ)I", (void*)&WB_StressVirtualSpaceResize}, +#if INCLUDE_CDS + {CC"getOffsetForName0", CC"(Ljava/lang/String;)I", (void*)&WB_GetOffsetForName}, +#endif #if INCLUDE_ALL_GCS {CC"g1InConcurrentMark", CC"()Z", (void*)&WB_G1InConcurrentMark}, {CC"g1IsHumongous0", CC"(Ljava/lang/Object;)Z", (void*)&WB_G1IsHumongous }, diff --git a/src/hotspot/share/runtime/arguments.cpp b/src/hotspot/share/runtime/arguments.cpp index 94f0a811112..820f656e9ae 100644 --- a/src/hotspot/share/runtime/arguments.cpp +++ b/src/hotspot/share/runtime/arguments.cpp @@ -3880,6 +3880,14 @@ jint Arguments::match_special_option_and_act(const JavaVMInitArgs* args, vm_exit(0); } #endif + + if (match_option(option, "-XX:+UseAppCDS")) { + Flag* flag = Flag::find_flag("SharedArchiveFile", 17, true, true); + if (flag->is_diagnostic()) { + flag->clear_diagnostic(); + } + continue; + } } return JNI_OK; } diff --git a/src/hotspot/share/runtime/arguments_ext.hpp b/src/hotspot/share/runtime/arguments_ext.hpp index d1c9f183e8e..3ae21e1267f 100644 --- a/src/hotspot/share/runtime/arguments_ext.hpp +++ b/src/hotspot/share/runtime/arguments_ext.hpp @@ -36,7 +36,6 @@ public: // Otherwise returns false. static inline bool process_options(const JavaVMOption *option) { return false; } static inline void report_unsupported_options() { } - static inline bool using_AppCDS() { return false; } }; void ArgumentsExt::set_gc_specific_flags() { diff --git a/src/hotspot/share/runtime/globals.hpp b/src/hotspot/share/runtime/globals.hpp index 68f95ad58a3..a6ae28a1683 100644 --- a/src/hotspot/share/runtime/globals.hpp +++ b/src/hotspot/share/runtime/globals.hpp @@ -3932,6 +3932,13 @@ public: "Address to allocate shared memory region for class data") \ range(0, SIZE_MAX) \ \ + product(bool, UseAppCDS, false, \ + "Enable Application Class Data Sharing when using shared spaces") \ + writeable(CommandLineOnly) \ + \ + product(ccstr, SharedArchiveConfigFile, NULL, \ + "Data to add to the CDS archive file") \ + \ product(uintx, SharedSymbolTableBucketSize, 4, \ "Average number of symbols per bucket in shared table") \ range(2, 246) \ diff --git a/test/hotspot/jtreg/TEST.groups b/test/hotspot/jtreg/TEST.groups index daf4480f452..d775c50bdb9 100644 --- a/test/hotspot/jtreg/TEST.groups +++ b/test/hotspot/jtreg/TEST.groups @@ -189,12 +189,27 @@ hotspot_tier1_runtime = \ -runtime/Unsafe/RangeCheck.java \ -runtime/containers/ \ sanity/ \ - testlibrary_tests/TestMutuallyExclusivePlatformPredicates.java + testlibrary_tests/TestMutuallyExclusivePlatformPredicates.java \ + -:hotspot_tier1_runtime_appcds_exclude hotspot_cds = \ runtime/SharedArchiveFile/ \ runtime/CompressedOops/ +# AppCDS +# If modifying AppCDS it is also recommended to run the open hotspot_cds group +hotspot_appcds = \ + runtime/appcds/ + +# A subset of AppCDS tests to be run in JPRT push +hotspot_tier1_runtime_appcds = \ + runtime/appcds/HelloTest.java \ + runtime/appcds/sharedStrings/SharedStringsBasic.java \ + runtime/appcds/ClassLoaderTest.java + +hotspot_tier1_runtime_appcds_exclude = \ + runtime/appcds/ \ + -:hotspot_tier1_runtime_appcds hotspot_tier1_serviceability = \ serviceability/dcmd/compiler \ diff --git a/test/hotspot/jtreg/runtime/appcds/AppCDSOptions.java b/test/hotspot/jtreg/runtime/appcds/AppCDSOptions.java new file mode 100644 index 00000000000..6db82a771ab --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/AppCDSOptions.java @@ -0,0 +1,45 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ +import jdk.test.lib.cds.CDSOptions; + +// This class represents options used for +// during creation of the archive and/or running JVM with archive + +public class AppCDSOptions extends CDSOptions { + public String appJar; + + // Application classes to be archived + public String[] appClasses; + + public AppCDSOptions setAppJar(String appJar) { + this.appJar = appJar; + return this; + } + + public AppCDSOptions setAppClasses(String[] appClasses) { + this.appClasses = appClasses; + return this; + } + +} diff --git a/test/hotspot/jtreg/runtime/appcds/AppendClasspath.java b/test/hotspot/jtreg/runtime/appcds/AppendClasspath.java new file mode 100644 index 00000000000..a59d1f3753b --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/AppendClasspath.java @@ -0,0 +1,87 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary At run time, it is OK to append new elements to the classpath that was used at dump time. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java + * @compile test-classes/HelloMore.java + * @run main AppendClasspath + */ + +import java.io.File; +import jdk.test.lib.process.OutputAnalyzer; + +public class AppendClasspath { + + public static void main(String[] args) throws Exception { + String appJar = JarBuilder.getOrCreateHelloJar(); + String appJar2 = JarBuilder.build("AppendClasspath_HelloMore", "HelloMore"); + + // Dump an archive with a specified JAR file in -classpath + TestCommon.testDump(appJar, TestCommon.list("Hello")); + + // PASS: 1) runtime with classpath containing the one used in dump time + OutputAnalyzer output = TestCommon.execCommon( + "-cp", appJar + File.pathSeparator + appJar2, + "HelloMore"); + TestCommon.checkExec(output); + + final String errorMessage1 = "Unable to use shared archive"; + final String errorMessage2 = "shared class paths mismatch"; + // FAIL: 2) runtime with classpath different from the one used in dump time + // (runtime has an extra jar file prepended to the class path) + output = TestCommon.execCommon( + "-cp", appJar2 + File.pathSeparator + appJar, + "HelloMore"); + output.shouldContain(errorMessage1); + output.shouldContain(errorMessage2); + output.shouldHaveExitValue(1); + + // FAIL: 3) runtime with classpath part of the one used in dump time + TestCommon.testDump(appJar + File.pathSeparator + appJar2, + TestCommon.list("Hello")); + output = TestCommon.execCommon( + "-cp", appJar2, + "Hello"); + output.shouldContain(errorMessage1); + output.shouldContain(errorMessage2); + output.shouldHaveExitValue(1); + + // FAIL: 4) runtime with same set of jar files in the classpath but + // with different order + output = TestCommon.execCommon( + "-cp", appJar2 + File.pathSeparator + appJar, + "HelloMore"); + output.shouldContain(errorMessage1); + output.shouldContain(errorMessage2); + output.shouldHaveExitValue(1); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/BootClassPathMismatch.java b/test/hotspot/jtreg/runtime/appcds/BootClassPathMismatch.java new file mode 100644 index 00000000000..04e6bb2625e --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/BootClassPathMismatch.java @@ -0,0 +1,108 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary bootclasspath mismatch test. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java + * @run main BootClassPathMismatch + */ + +import jdk.test.lib.process.OutputAnalyzer; +import java.io.File; +import java.nio.file.Files; +import java.nio.file.FileAlreadyExistsException; +import java.nio.file.StandardCopyOption; +import java.nio.file.Paths; + + +public class BootClassPathMismatch { + private static final String mismatchMessage = "shared class paths mismatch"; + + public static void main(String[] args) throws Exception { + JarBuilder.getOrCreateHelloJar(); + copyHelloToNewDir(); + + BootClassPathMismatch test = new BootClassPathMismatch(); + test.testBootClassPathMismatch(); + test.testBootClassPathMatch(); + } + + /* Error should be detected if: + * dump time: -Xbootclasspath/a:${testdir}/hello.jar + * run-time : -Xbootclasspath/a:${testdir}/newdir/hello.jar + */ + public void testBootClassPathMismatch() throws Exception { + String appJar = JarBuilder.getOrCreateHelloJar(); + String appClasses[] = {"Hello"}; + OutputAnalyzer dumpOutput = TestCommon.dump( + appJar, appClasses, "-Xbootclasspath/a:" + appJar); + String testDir = TestCommon.getTestDir("newdir"); + String otherJar = testDir + File.separator + "hello.jar"; + OutputAnalyzer execOutput = TestCommon.exec( + appJar, "-verbose:class", "-Xbootclasspath/a:" + otherJar, "Hello"); + try { + TestCommon.checkExec(execOutput, mismatchMessage); + } catch (java.lang.RuntimeException re) { + String cause = re.getMessage(); + if (!mismatchMessage.equals(cause)) { + throw re; + } + } + } + + /* No error if: + * dump time: -Xbootclasspath/a:${testdir}/hello.jar + * run-time : -Xbootclasspath/a:${testdir}/hello.jar + */ + public void testBootClassPathMatch() throws Exception { + String appJar = TestCommon.getTestJar("hello.jar"); + String appClasses[] = {"Hello"}; + OutputAnalyzer dumpOutput = TestCommon.dump( + appJar, appClasses, "-Xbootclasspath/a:" + appJar); + OutputAnalyzer execOutput = TestCommon.exec( + appJar, "-verbose:class", + "-Xbootclasspath/a:" + appJar, "Hello"); + TestCommon.checkExec(execOutput, + "[class,load] Hello source: shared objects file"); + } + + private static void copyHelloToNewDir() throws Exception { + String classDir = System.getProperty("test.classes"); + String dstDir = classDir + File.separator + "newdir"; + try { + Files.createDirectory(Paths.get(dstDir)); + } catch (FileAlreadyExistsException e) { } + + Files.copy(Paths.get(classDir, "hello.jar"), + Paths.get(dstDir, "hello.jar"), + StandardCopyOption.REPLACE_EXISTING); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/CaseSensitiveClassPath.java b/test/hotspot/jtreg/runtime/appcds/CaseSensitiveClassPath.java new file mode 100644 index 00000000000..56315c16d64 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/CaseSensitiveClassPath.java @@ -0,0 +1,92 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + + +/* + * @test + * @summary Test case sensitive aspect of comparing class paths + * between dump time and archive use time + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @requires os.family != "mac" + * @compile test-classes/Hello.java + * @run main CaseSensitiveClassPath + */ + +import java.nio.file.FileAlreadyExistsException; +import java.nio.file.Files; +import java.nio.file.Path; +import java.nio.file.Paths; +import java.nio.file.StandardCopyOption; +import jdk.test.lib.Platform; +import jdk.test.lib.process.OutputAnalyzer; + + +// Excluded from running on MAC: a more comprehensive case sensitivity detection +// and fix mechanism is needed, which is planned to be implemented in the future. +public class CaseSensitiveClassPath { + public static void main(String[] args) throws Exception { + String appJar = JarBuilder.getOrCreateHelloJar(); + String appJarUpper = appJar.replace("hello", "Hello"); + + OutputAnalyzer out = TestCommon.dump(appJar, TestCommon.list("Hello")); + TestCommon.checkDump(out); + + Path jarPath = Paths.get(appJar); + Path jarPathUpper = null; + + boolean fileExists = false; + try { + jarPathUpper = Files.createFile(Paths.get(appJarUpper)); + } catch (FileAlreadyExistsException faee) { + fileExists = true; + } + + if (!fileExists) { + try { + Files.copy(jarPath, jarPathUpper, StandardCopyOption.REPLACE_EXISTING); + } catch (Exception e) { + throw new java.lang.RuntimeException( + "Failed copying file from " + appJar + " to " + appJarUpper + ".", e); + } + } else { + jarPathUpper = Paths.get(appJarUpper); + } + + out = TestCommon.exec(appJarUpper, "Hello", "-Xlog:class+path=info", + "-Xlog:cds"); + if (TestCommon.isUnableToMap(out)) + return; + + if (Files.isSameFile(jarPath, jarPathUpper)) { + TestCommon.checkExec(out, "Hello World"); + } else { + out.shouldContain("shared class paths mismatch") + .shouldHaveExitValue(1); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/ClassLoaderTest.java b/test/hotspot/jtreg/runtime/appcds/ClassLoaderTest.java new file mode 100644 index 00000000000..8012a1de39a --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/ClassLoaderTest.java @@ -0,0 +1,93 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Initiating and defining classloader test. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java + * @compile test-classes/HelloWB.java + * @compile test-classes/ForNameTest.java + * @compile test-classes/BootClassPathAppendHelper.java + * @build sun.hotspot.WhiteBox + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @run main ClassLoaderTest + */ + +import java.io.File; +import jdk.test.lib.process.OutputAnalyzer; + +public class ClassLoaderTest { + public static void main(String[] args) throws Exception { + JarBuilder.build(true, "ClassLoaderTest-WhiteBox", "sun/hotspot/WhiteBox"); + JarBuilder.getOrCreateHelloJar(); + JarBuilder.build("ClassLoaderTest-HelloWB", "HelloWB"); + JarBuilder.build("ClassLoaderTest-ForName", "ForNameTest"); + ClassLoaderTest test = new ClassLoaderTest(); + test.testBootLoader(); + test.testDefiningLoader(); + } + + public void testBootLoader() throws Exception { + String appJar = TestCommon.getTestJar("ClassLoaderTest-HelloWB.jar"); + String appClasses[] = {"HelloWB"}; + String whiteBoxJar = TestCommon.getTestJar("ClassLoaderTest-WhiteBox.jar"); + String bootClassPath = "-Xbootclasspath/a:" + appJar + + File.pathSeparator + whiteBoxJar; + + TestCommon.dump(appJar, appClasses, bootClassPath); + + OutputAnalyzer runtimeOutput = TestCommon.execCommon( + "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI", + "-cp", appJar, bootClassPath, "-Xlog:class+load", "HelloWB"); + + if (!TestCommon.isUnableToMap(runtimeOutput)) { + runtimeOutput.shouldNotContain( + "[class,load] HelloWB source: shared objects file by jdk/internal/misc/ClassLoaders$AppClassLoader"); + runtimeOutput.shouldContain("[class,load] HelloWB source: shared objects file"); + } + } + + public void testDefiningLoader() throws Exception { + // The boot loader should be used to load the class when it's + // on the bootclasspath, regardless who is the initiating classloader. + // In this test case, the AppClassLoader is the initiating classloader. + String helloJar = TestCommon.getTestJar("hello.jar"); + String appJar = helloJar + System.getProperty("path.separator") + + TestCommon.getTestJar("ClassLoaderTest-ForName.jar"); + String whiteBoxJar = TestCommon.getTestJar("ClassLoaderTest-WhiteBox.jar"); + String bootClassPath = "-Xbootclasspath/a:" + helloJar + + File.pathSeparator + whiteBoxJar; + + TestCommon.dump(helloJar, TestCommon.list("Hello"), bootClassPath); + + TestCommon.execCommon("-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI", + "-cp", appJar, bootClassPath, "-XX:+TraceClassPaths", "ForNameTest"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/ClassPathAttr.java b/test/hotspot/jtreg/runtime/appcds/ClassPathAttr.java new file mode 100644 index 00000000000..d32f7b8f2be --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/ClassPathAttr.java @@ -0,0 +1,106 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Class-Path: attribute in MANIFEST file + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @run main ClassPathAttr + */ + +import jdk.test.lib.process.OutputAnalyzer; +import java.io.File; +import java.nio.file.Files; +import java.nio.file.FileAlreadyExistsException; +import java.nio.file.StandardCopyOption; +import java.nio.file.Paths; + + +public class ClassPathAttr { + + public static void main(String[] args) throws Exception { + buildCpAttr("cpattr1", "cpattr1.mf", "CpAttr1", "CpAttr1"); + buildCpAttr("cpattr1_long", "cpattr1_long.mf", "CpAttr1", "CpAttr1"); + buildCpAttr("cpattr2", "cpattr2.mf", "CpAttr2", "CpAttr2"); + buildCpAttr("cpattr3", "cpattr3.mf", "CpAttr3", "CpAttr2", "CpAttr3"); + buildCpAttr("cpattr4", "cpattr4.mf", "CpAttr4", + "CpAttr2", "CpAttr3", "CpAttr4", "CpAttr5"); + buildCpAttr("cpattr5_123456789_223456789_323456789_423456789_523456789_623456789", "cpattr5_extra_long.mf", "CpAttr5", "CpAttr5"); + + for (int i=1; i<=2; i++) { + String jar1 = TestCommon.getTestJar("cpattr1.jar"); + String jar4 = TestCommon.getTestJar("cpattr4.jar"); + if (i == 2) { + // Test case #2 -- same as #1, except we use cpattr1_long.jar, which has a super-long + // Class-Path: attribute. + jar1 = TestCommon.getTestJar("cpattr1_long.jar"); + } + String cp = jar1 + File.pathSeparator + jar4; + + TestCommon.testDump(cp, TestCommon.list("CpAttr1", + "CpAttr2", + "CpAttr3", + "CpAttr4", + "CpAttr5")); + + OutputAnalyzer output = TestCommon.execCommon( + "-cp", cp, + "CpAttr1"); + TestCommon.checkExec(output); + + // Logging test for class+path. + output = TestCommon.execCommon( + "-Xlog:class+path", + "-cp", cp, + "CpAttr1"); + if (!TestCommon.isUnableToMap(output)){ + output.shouldMatch("checking shared classpath entry: .*cpattr2.jar"); + output.shouldMatch("checking shared classpath entry: .*cpattr3.jar"); + } + // Make sure aliased TraceClassPaths still works + output = TestCommon.execCommon( + "-XX:+TraceClassPaths", + "-cp", cp, + "CpAttr1"); + if (!TestCommon.isUnableToMap(output)){ + output.shouldMatch("checking shared classpath entry: .*cpattr2.jar"); + output.shouldMatch("checking shared classpath entry: .*cpattr3.jar"); + } + } + } + + private static void buildCpAttr(String jarName, String manifest, String enclosingClassName, String ...testClassNames) throws Exception { + String jarClassesDir = System.getProperty("test.classes") + File.separator + jarName + "_classes"; + try { Files.createDirectory(Paths.get(jarClassesDir)); } catch (FileAlreadyExistsException e) { } + + JarBuilder.compile(jarClassesDir, System.getProperty("test.src") + File.separator + + "test-classes" + File.separator + enclosingClassName + ".java"); + JarBuilder.buildWithManifest(jarName, manifest, jarClassesDir, testClassNames); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/CommandLineFlagCombo.java b/test/hotspot/jtreg/runtime/appcds/CommandLineFlagCombo.java new file mode 100644 index 00000000000..8f1fc68b81b --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/CommandLineFlagCombo.java @@ -0,0 +1,128 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test CommandLineFlagCombo + * AppCDS does not support uncompressed oops + * @requires (vm.gc=="null") & ((vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)) + * @summary Test command line flag combinations that + * could likely affect the behaviour of AppCDS + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java + * @run main/timeout=240 CommandLineFlagCombo + */ + +import jdk.test.lib.BuildHelper; +import jdk.test.lib.Platform; +import jdk.test.lib.process.OutputAnalyzer; + +public class CommandLineFlagCombo { + + // shared base address test table + private static final String[] testTable = { + "-XX:+UseG1GC", "-XX:+UseSerialGC", "-XX:+UseParallelGC", "-XX:+UseConcMarkSweepGC", + "-XX:+FlightRecorder", + "-XX:+UseLargePages", // may only take effect on machines with large-pages + "-XX:+UseCompressedClassPointers", + "-XX:+UseCompressedOops", + "-XX:ObjectAlignmentInBytes=16", + "-XX:ObjectAlignmentInBytes=32", + "-XX:ObjectAlignmentInBytes=64" + }; + + public static void main(String[] args) throws Exception { + String appJar = JarBuilder.getOrCreateHelloJar(); + String classList[] = {"Hello"}; + + for (String testEntry : testTable) { + System.out.println("CommandLineFlagCombo = " + testEntry); + + if (skipTestCase(testEntry)) + continue; + + OutputAnalyzer dumpOutput; + + if (testEntry.equals("-XX:+FlightRecorder")) { + dumpOutput = TestCommon.dump(appJar, classList, "-XX:+UnlockCommercialFeatures", testEntry); + } else { + dumpOutput = TestCommon.dump(appJar, classList, testEntry); + } + + TestCommon.checkDump(dumpOutput, "Loading classes to share"); + + OutputAnalyzer execOutput; + if (testEntry.equals("-XX:+FlightRecorder")) { + execOutput = TestCommon.exec(appJar, "-XX:+UnlockCommercialFeatures", testEntry, "Hello"); + } else { + execOutput = TestCommon.exec(appJar, testEntry, "Hello"); + } + TestCommon.checkExec(execOutput, "Hello World"); + } + + for (int i=0; i<2; i++) { + String g1Flag, serialFlag; + + // Interned strings are supported only with G1GC. However, we should not crash if: + // 0: archive has shared strings, but run time doesn't support shared strings + // 1: archive has no shared strings, but run time supports shared strings + + String dump_g1Flag = "-XX:" + (i == 0 ? "+" : "-") + "UseG1GC"; + String run_g1Flag = "-XX:" + (i != 0 ? "+" : "-") + "UseG1GC"; + String dump_serialFlag = "-XX:" + (i != 0 ? "+" : "-") + "UseSerialGC"; + String run_serialFlag = "-XX:" + (i == 0 ? "+" : "-") + "UseSerialGC"; + + OutputAnalyzer dumpOutput = TestCommon.dump( + appJar, classList, dump_g1Flag, dump_serialFlag); + + TestCommon.checkDump(dumpOutput, "Loading classes to share"); + + OutputAnalyzer execOutput = TestCommon.exec(appJar, run_g1Flag, run_serialFlag, "Hello"); + TestCommon.checkExec(execOutput, "Hello World"); + } + } + + private static boolean skipTestCase(String testEntry) throws Exception { + if (Platform.is32bit()) + { + if (testEntry.equals("-XX:+UseCompressedOops") || + testEntry.equals("-XX:+UseCompressedClassPointers") || + testEntry.contains("ObjectAlignmentInBytes") ) + { + System.out.println("Test case not applicable on 32-bit platforms"); + return true; + } + } + + if (!BuildHelper.isCommercialBuild() && testEntry.equals("-XX:+FlightRecorder")) + { + System.out.println("Test case not applicable on non-commercial builds"); + return true; + } + + return false; + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/CommandLineFlagComboNegative.java b/test/hotspot/jtreg/runtime/appcds/CommandLineFlagComboNegative.java new file mode 100644 index 00000000000..75effb9926c --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/CommandLineFlagComboNegative.java @@ -0,0 +1,101 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test CommandLineFlagComboNegative + * @summary Test command line flag combinations that differ between + * the dump and execute steps, in such way that they cause errors + * E.g. use compressed oops for creating and archive, but then + * execute w/o compressed oops + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java + * @run main CommandLineFlagComboNegative + */ + +import java.util.ArrayList; +import jdk.test.lib.Platform; +import jdk.test.lib.process.OutputAnalyzer; + +public class CommandLineFlagComboNegative { + + private class TestVector { + public String testOptionForDumpStep; + public String testOptionForExecuteStep; + public String expectedErrorMsg; + public int expectedErrorCode; + + public TestVector(String testOptionForDumpStep, String testOptionForExecuteStep, + String expectedErrorMsg, int expectedErrorCode) { + this.testOptionForDumpStep=testOptionForDumpStep; + this.testOptionForExecuteStep=testOptionForExecuteStep; + this.expectedErrorMsg=expectedErrorMsg; + this.expectedErrorCode=expectedErrorCode; + } + } + + private ArrayList testTable = new ArrayList(); + + private void initTestTable() { + // These options are not applicable on 32-bit platforms + if (Platform.is64bit()) { + testTable.add( new TestVector("-XX:ObjectAlignmentInBytes=8", "-XX:ObjectAlignmentInBytes=16", + "An error has occurred while processing the shared archive file", 1) ); + testTable.add( new TestVector("-XX:ObjectAlignmentInBytes=64", "-XX:ObjectAlignmentInBytes=32", + "An error has occurred while processing the shared archive file", 1) ); + testTable.add( new TestVector("-XX:+UseCompressedOops", "-XX:-UseCompressedOops", + "Class data sharing is inconsistent with other specified options", 1) ); + testTable.add( new TestVector("-XX:+UseCompressedClassPointers", "-XX:-UseCompressedClassPointers", + "Class data sharing is inconsistent with other specified options", 1) ); + } + } + + private void runTests() throws Exception + { + for (TestVector testEntry : testTable) { + System.out.println("CommandLineFlagComboNegative: dump = " + testEntry.testOptionForDumpStep); + System.out.println("CommandLineFlagComboNegative: execute = " + testEntry.testOptionForExecuteStep); + + String appJar = JarBuilder.getOrCreateHelloJar(); + OutputAnalyzer dumpOutput = TestCommon.dump( + appJar, new String[] {"Hello"}, testEntry.testOptionForDumpStep); + + TestCommon.checkDump(dumpOutput, "Loading classes to share"); + + OutputAnalyzer execOutput = TestCommon.exec(appJar, testEntry.testOptionForExecuteStep, "Hello"); + execOutput.shouldContain(testEntry.expectedErrorMsg); + execOutput.shouldHaveExitValue(testEntry.expectedErrorCode); + } + } + + public static void main(String[] args) throws Exception { + CommandLineFlagComboNegative thisClass = new CommandLineFlagComboNegative(); + thisClass.initTestTable(); + thisClass.runTests(); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/CompilerUtils.java b/test/hotspot/jtreg/runtime/appcds/CompilerUtils.java new file mode 100644 index 00000000000..cfb5d20ba5c --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/CompilerUtils.java @@ -0,0 +1,80 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import javax.tools.JavaCompiler; +import javax.tools.StandardJavaFileManager; +import javax.tools.StandardLocation; +import javax.tools.ToolProvider; +import java.io.IOException; +import java.nio.file.Files; +import java.nio.file.Path; +import java.util.Arrays; +import java.util.List; +import java.util.stream.Collectors; + +/** + * This class consists exclusively of static utility methods for invoking the + * java compiler. + * + * This class will eventually move to jdk.testlibrary. + */ + +public final class CompilerUtils { + private CompilerUtils() { } + + /** + * Compile all the java sources in {@code /**} to + * {@code /**}. The destination directory will be created if + * it doesn't exist. + * + * All warnings/errors emitted by the compiler are output to System.out/err. + * + * @return true if the compilation is successful + * + * @throws IOException if there is an I/O error scanning the source tree or + * creating the destination directory + */ + public static boolean compile(Path source, Path destination, String ... options) + throws IOException + { + JavaCompiler compiler = ToolProvider.getSystemJavaCompiler(); + StandardJavaFileManager jfm = compiler.getStandardFileManager(null, null, null); + + List sources + = Files.find(source, Integer.MAX_VALUE, + (file, attrs) -> (file.toString().endsWith(".java"))) + .collect(Collectors.toList()); + + Files.createDirectories(destination); + jfm.setLocationFromPaths(StandardLocation.CLASS_OUTPUT, + Arrays.asList(destination)); + + List opts = Arrays.asList(options); + JavaCompiler.CompilationTask task + = compiler.getTask(null, jfm, null, opts, null, + jfm.getJavaFileObjectsFromPaths(sources)); + + return task.call(); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/DumpClassList.java b/test/hotspot/jtreg/runtime/appcds/DumpClassList.java new file mode 100644 index 00000000000..c2670a7ef45 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/DumpClassList.java @@ -0,0 +1,103 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary DumpLoadedClassList should exclude generated classes, classes in bootclasspath/a and + * --patch-module. + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * @compile test-classes/ArrayListTest.java + * @run main DumpClassList + */ + +import jdk.test.lib.compiler.InMemoryJavaCompiler; +import jdk.test.lib.process.OutputAnalyzer; +import jdk.test.lib.process.ProcessTools; + +public class DumpClassList { + public static void main(String[] args) throws Exception { + // build The app + String[] appClass = new String[] {"ArrayListTest"}; + String classList = "app.list"; + + JarBuilder.build("app", appClass[0]); + String appJar = TestCommon.getTestJar("app.jar"); + + // build patch-module + String source = "package java.lang; " + + "public class NewClass { " + + " static { " + + " System.out.println(\"NewClass\"); "+ + " } " + + "}"; + + ClassFileInstaller.writeClassToDisk("java/lang/NewClass", + InMemoryJavaCompiler.compile("java.lang.NewClass", source, "--patch-module=java.base"), + System.getProperty("test.classes")); + + String patchJar = JarBuilder.build("javabase", "java/lang/NewClass"); + + // build bootclasspath/a + String source2 = "package boot.append; " + + "public class Foo { " + + " static { " + + " System.out.println(\"Foo\"); " + + " } " + + "}"; + + ClassFileInstaller.writeClassToDisk("boot/append/Foo", + InMemoryJavaCompiler.compile("boot.append.Foo", source2), + System.getProperty("test.classes")); + + String appendJar = JarBuilder.build("bootappend", "boot/append/Foo"); + + // dump class list + ProcessBuilder pb = ProcessTools.createJavaProcessBuilder( + true, + "-XX:DumpLoadedClassList=" + classList, + "--patch-module=java.base=" + patchJar, + "-Xbootclasspath/a:" + appendJar, + "-cp", + appJar, + appClass[0]); + OutputAnalyzer output = TestCommon.executeAndLog(pb, "dumpClassList"); + TestCommon.checkExecReturn(output, 0, true, + "hello world", + "skip writing class java/lang/NewClass") // skip classes outside of jrt image + .shouldNotContain("skip writing class boot/append/Foo"); // but classes on -Xbootclasspath/a should not be skipped + + output = TestCommon.createArchive(appJar, appClass, + "-Xbootclasspath/a:" + appendJar, + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+PrintSystemDictionaryAtExit", + "-XX:SharedClassListFile=" + classList); + TestCommon.checkDump(output) + .shouldNotContain("Preload Warning: Cannot find java/lang/invoke/LambdaForm") + .shouldNotContain("Preload Warning: Cannot find boot/append/Foo") + .shouldContain("boot.append.Foo, loader "); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_1.txt b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_1.txt new file mode 100644 index 00000000000..1f4be1af531 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_1.txt @@ -0,0 +1,11 @@ +VERSION: 1.0 +@SECTION: Symbol +0 -1: +41 -1: (Ljava/util/Set;Ljava/lang/Object;)V +11 -1 linkMethod +18 -1: type can't be null +20 -1: isAlphaNumericString +43 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Z +1 -1: \t +15 -1: IntCumulateTask +1 -1: \n diff --git a/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_2.txt b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_2.txt new file mode 100644 index 00000000000..f45450da674 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_2.txt @@ -0,0 +1,5 @@ +@SECTION: Symbol +20 -1: isAlphaNumericString +43 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Z +15 -1: IntCumulateTask +1 -1: \n diff --git a/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_3.txt b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_3.txt new file mode 100644 index 00000000000..360e94b24fd --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_3.txt @@ -0,0 +1,13 @@ +VERSION: 1.0 +@SECTION: Symbol +11 -1: linkMethod +18 -1: isAlphaNumericString +33 -1: java/util/Locale$LocaleNameGetter +23 -1: sun/invoke/util/Wrapper +12 -1: reduceToLong +11 -1: setReadOnly +8 -1: endsWith +55 -1: (Ljava/lang/ClassValue;TT;)V +20 -1: createAnnotationData +6 -1: OfLong +17 -1: getClassSignature diff --git a/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.java b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.java new file mode 100644 index 00000000000..4fc3bb8757e --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.java @@ -0,0 +1,89 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Adding extra symbols into CDS archive using -XX:SharedArchiveConfigFile + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java + * @run main ExtraSymbols + */ + +import java.io.*; +import jdk.test.lib.process.OutputAnalyzer; + +public class ExtraSymbols { + public static void main(String[] args) throws Exception { + String appJar = JarBuilder.getOrCreateHelloJar(); + + // 1. Dump without extra symbols. + OutputAnalyzer output = TestCommon.dump(appJar, TestCommon.list("Hello")); + checkOutput(output); + int numEntries1 = numOfEntries(output); + + // 2. Dump an archive with extra symbols. All symbols in + // ExtraSymbols.symbols.txt are valid. Dumping should succeed. + output = TestCommon.dump(appJar, TestCommon.list("Hello"), + "-XX:SharedArchiveConfigFile=" + TestCommon.getSourceFile("ExtraSymbols.symbols.txt")); + checkOutput(output); + int numEntries2 = numOfEntries(output); + if (numEntries2 <= numEntries1) { + throw new RuntimeException("No extra symbols added to archive"); + } + output = TestCommon.exec(appJar, "Hello"); + TestCommon.checkExec(output); + + // 3. Dump with invalid symbol files. Dumping should fail. + String invalid_symbol_files[] = {"ExtraSymbols.invalid_1.txt", + "ExtraSymbols.invalid_2.txt", + "ExtraSymbols.invalid_3.txt"}; + String err_msgs[] = {"Corrupted at line", + "wrong version of hashtable dump file", + "Corrupted at line"}; + for (int i = 0; i < invalid_symbol_files.length; i++) { + output = TestCommon.dump(appJar, TestCommon.list("Hello"), + "-XX:SharedArchiveConfigFile=" + + TestCommon.getSourceFile(invalid_symbol_files[i])); + output.shouldContain("Error occurred during initialization of VM"); + output.shouldContain(err_msgs[i]); + } + } + + static int numOfEntries(OutputAnalyzer output) { + String s = output.firstMatch("Number of entries : .*"); + String subs[] = s.split("[:]"); + int numEntries = Integer.parseInt(subs[1].trim()); + return numEntries; + } + + static void checkOutput(OutputAnalyzer output) throws Exception { + output.shouldContain("Loading classes to share"); + output.shouldContain("Shared symbol table stats -------- base:"); + output.shouldHaveExitValue(0); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.symbols.txt b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.symbols.txt new file mode 100644 index 00000000000..9a75ededb39 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.symbols.txt @@ -0,0 +1,10826 @@ +VERSION: 1.0 +@SECTION: Symbol +69 -1: ------------------------------------------------------------123456789 +68 -1: # The values in this file are only used for testing the operation of +63 -1: # adding extra symbols into the CDS archive. None of the values +70 -1: # are interpreted in any way. So even if they contain names of classes +70 -1: # that have been renamed or removed, or string literals that have been +66 -1: # changed or remove from Java source code, it would not affect the +26 -1: # correctness of the test. +0 -1: +41 -1: (Ljava/util/Set;Ljava/lang/Object;)V +11 -1: linkMethod +18 -1: type can't be null +20 -1: isAlphaNumericString +43 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Z +72 -1: (Ljava/lang/String;[Ljava/lang/String;Ljava/io/File;)Ljava/lang/Process; +1 -1: \t +15 -1: IntCumulateTask +1 -1: \n +33 -1: java/util/Locale$LocaleNameGetter +23 -1: sun/invoke/util/Wrapper +57 -1: (Ljava/io/InputStream;Ljava/nio/charset/CharsetDecoder;)V +12 -1: reduceToLong +11 -1: setReadOnly +34 -1: (Ljava/lang/reflect/Executable;)[B +54 -1: ([Ljava/net/URL;Ljava/security/AccessControlContext;)V +15 -1: LegacyMergeSort +8 -1: endsWith +55 -1: (Ljava/lang/ClassValue;TT;)V +20 -1: createAnnotationData +6 -1: OfLong +90 -1: (Ljava/util/Map;)Ljava/util/Map; +1 -1: +17 -1: getClassSignature +1 -1: " +1 -1: # +1 -1: ( +21 -1: MethodHandleImpl.java +10 -1: getUTF8At0 +1 -1: ) +1 -1: * +1 -1: + +1 -1: , +1 -1: - +1 -1: . +18 -1: unsignedEntryNames +1 -1: / +1 -1: 0 +19 -1: java/io/InputStream +38 -1: java/util/concurrent/ThreadLocalRandom +1 -1: : +1 -1: ; +1 -1: < +13 -1: getAndAddLong +1 -1: = +1 -1: > +1 -1: ? +20 -1: getMethodAtIfLoaded0 +1 -1: @ +1 -1: A +7 -1: isAlive +1 -1: B +10 -1: checkIndex +1 -1: C +1 -1: D +1 -1: E +1 -1: F +1 -1: I +30 -1: sun/misc/JavaUtilZipFileAccess +11 -1: classloader +1 -1: J +1 -1: L +14 -1: packageEnabled +8 -1: ([BIII)V +24 -1: Ljava/io/BufferedWriter; +1 -1: S +32 -1: (Ljava/util/function/Consumer;)V +11 -1: refKindName +1 -1: U +1 -1: V +3 1: yyy +18 -1: JavaNetAccess.java +1 -1: Z +7 -1: members +1 -1: [ +1 -1: ] +13 -1: ShortLanguage +1 -1: _ +9 -1: invoke__L +28 -1: (D)Ljava/lang/StringBuilder; +15 -1: isInvokeSpecial +1 -1: c +17 -1: subListRangeCheck +1 -1: e +29 -1: Ljava/security/AllPermission; +27 -1: (C)Ljava/lang/StringBuffer; +28 -1: ([Ljava/lang/Comparable;II)V +50 -1: (Ljava/util/zip/ZipFile;Ljava/util/zip/Inflater;)V +9 -1: invoke__V +1 -1: m +101 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetEncoder;)Lsun/nio/cs/StreamEncoder; +13 -1: MAX_SURROGATE +18 -1: Ljava/lang/String; +21 -1: ensureProtectedAccess +18 -1: getIfModifiedSince +1 -1: r +9 -1: setExtra0 +1 -1: s +47 -1: Ljava/lang/Enum; +1 -1: x +1 -1: { +7 -1: getLast +1 -1: | +1 -1: } +1 -1: ~ +71 -1: (Ljava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$KeySetView; +34 -1: (Ljava/nio/charset/Charset;[BII)[C +10 -1: DST_NSHIFT +25 -1: ForEachTransformedKeyTask +26 -1: Ljava/nio/charset/Charset; +56 -1: (Ljava/lang/reflect/Method;)Lsun/reflect/MethodAccessor; +22 -1: StackTraceElement.java +24 -1: sun.zip.zipFile.openTime +27 -1: JNI_COPY_TO_ARRAY_THRESHOLD +26 -1: java/lang/ClassValue$Entry +19 -1: [Ljava/lang/Thread; +56 -1: (Ljava/lang/ClassLoader$NativeLibrary;)Ljava/lang/Class; +7 -1: message +18 -1: parameterToArgSlot +20 -1: [[Ljava/lang/String; +11 -1: bumpVersion +26 -1: Ljava/lang/reflect/Method; +9 -1: getMethod +6 -1: (I)TE; +49 -1: (Ljava/lang/String;)Ljava/lang/invoke/MemberName; +33 -1: sun/misc/URLClassPath$JarLoader$1 +57 -1: (BLjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;)V +33 -1: sun/misc/URLClassPath$JarLoader$2 +33 -1: sun/misc/URLClassPath$JarLoader$3 +87 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/HashMap$Node;)Ljava/util/HashMap$Node; +19 -1: FileDescriptor.java +12 -1: forEachValue +36 -1: (Ljava/util/List;)[Ljava/lang/Class; +53 -1: (Ljava/lang/CharSequence;II)Ljava/lang/StringBuilder; +8 -1: hasArray +4 -1: ROWS +10 -1: linkMethod +9 -1: remaining +23 -1: ARRAY_FLOAT_BASE_OFFSET +35 -1: java/lang/reflect/ReflectPermission +24 -1: ()Ljava/net/InetAddress; +7 -1: ngroups +81 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction;>; +10 -1: putTreeVal +4 -1: list +5 -1: trace +7 -1: blocker +21 -1: reset() not supported +8 -1: JAPANESE +11 -1: PRIVATE_USE +53 -1: (Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodHandle; +32 -1: Invalid JavaFX launch parameters +15 -1: SECONDS_PER_DAY +11 -1: UTF_16.java +24 -1: sun/nio/cs/UTF_8$Encoder +102 -1: (Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)V +20 -1: (Lsun/misc/Signal;)V +22 -1: MagicAccessorImpl.java +84 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/CodeSource;)Ljava/lang/Class; +14 -1: altMetafactory +13 -1: queryOverflow +30 -1: exists, but is not accessible +3 -1: edt +14 -1: MAX_ARRAY_SIZE +20 -1: aliases_UTF_16LE_BOM +34 -1: Ljava/lang/reflect/Constructor<*>; +20 -1: (S)Ljava/lang/Short; +6 -1: STRICT +19 -1: internalCallerClass +27 -1: java/nio/DirectLongBufferRU +13 -1: TIMED_WAITING +15 -1: toGenericString +6 -1: client +10 -1: attachImpl +22 -1: ReflectionFactory.java +8 -1: jsse.jar +37 -1: (IZ)Ljava/lang/AbstractStringBuilder; +41 -1: java/util/LinkedHashMap$LinkedKeyIterator +15 -1: computeIfAbsent +10 -1: GET_TARGET +53 -1: ;>(Ljava/lang/Class;)[TE; +35 -1: java/util/Collections$SingletonList +7 -1: addYear +35 -1: Ljava/lang/Class; +65 -1: (Ljava/util/LinkedHashMap$Entry;Ljava/util/LinkedHashMap$Entry;)V +14 -1: image/x-bitmap +10 -1: (IIII[JI)V +50 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/net/URL;)V +13 -1: getLineNumber +20 -1: toUpperCaseCharArray +62 -1: (Ljava/util/concurrent/locks/Condition;)Ljava/util/Collection; +11 -1: rotateRight +10 -1: checkPtype +85 -1: (JLjava/util/function/ToLongFunction<-TK;>;JLjava/util/function/LongBinaryOperator;)J +81 -1: (Ljava/lang/Class;Ljava/lang/reflect/Constructor;)Ljava/lang/reflect/Constructor; +15 -1: Illegal style: +28 -1: (Ljava/lang/StringBuilder;)V +41 -1: 1.8.0-internal-iklam_2013_11_27_21_25-b00 +25 -1: Invalid authority field: +55 -1: (Ljava/lang/CharSequence;)Ljava/util/function/Supplier; +12 -1: staticOffset +32 -1: java/util/HashMap$KeySpliterator +13 -1: javaNioAccess +24 -1: (Ljava/util/SortedSet;)V +17 -1: thenComparingLong +2 -1: \n\n +22 -1: registerFieldsToFilter +34 -1: java/lang/invoke/LambdaMetafactory +225 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsTask;Ljava/util/function/BiFunction;Ljava/util/function/BiFunction;)V +26 -1: [[Ljava/lang/CharSequence; +32 -1: java/util/Collections$CheckedMap +147 -1: Ljava/util/AbstractSequentialList;Ljava/util/List;Ljava/util/Deque;Ljava/lang/Cloneable;Ljava/io/Serializable; +204 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/CallSite; +27 -1: sun/nio/cs/UTF_16BE$Decoder +12 -1: getZoneInfo0 +77 -1: (Ljava/lang/Class;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodType; +9 -1: Traverser +35 -1: Ljava/lang/ref/ReferenceQueue; +27 -1: lambda$comparing$ea9a8b3a$1 +7 -1: ([CI)[C +6 -1: getenv +9 -1: newMethod +52 -1: Ljava/lang/reflect/Executable; +164 -1: (Ljava/security/ProtectionDomain;Ljava/security/DomainCombiner;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)V +40 -1: (Ljava/lang/String;)Ljava/util/TimeZone; +11 -1: countTokens +202 -1: Ljava/util/concurrent/ConcurrentHashMap$CollectionView;>;Ljava/util/Set;>;Ljava/io/Serializable; +78 -1: (Ljava/util/Collection;)Ljava/util/Collection; +34 -1: (Ljava/lang/reflect/Constructor;)I +15 -1: comparingDouble +24 -1: ()Ljava/util/Collection; +14 -1: invokeFinalize +14 -1: encodeISOArray +77 -1: (Ljava/lang/ref/Reference;Ljava/lang/ref/Reference;)Ljava/lang/ref/Reference; +11 -1: bad index: +34 -1: (Ljava/lang/reflect/Constructor;)V +68 -1: (Ljava/util/jar/JarEntry;Lsun/security/util/ManifestEntryVerifier;)V +53 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;IIIJ)V +27 -1: ([CII)Ljava/nio/CharBuffer; +6 -1: setOut +41 -1: (ILjava/lang/Object;Ljava/lang/Object;I)V +12 -1: MIN_EXPONENT +30 -1: PrivilegedExceptionAction.java +18 -1: key cannot be null +6 -1: CENHDR +73 -1: (ITK;TV;Ljava/util/HashMap$Node;)Ljava/util/HashMap$Node; +23 -1: java/lang/reflect/Array +8 -1: AF_LIMIT +2 -1: \r\n +11 -1: getFileName +10 -1: parseShort +22 -1: java/lang/LinkageError +15 -1: FT_LAST_WRAPPER +32 -1: java/util/ArrayDeque$DeqIterator +24 -1: pc-multilingual-850+euro +3 -1: zfc +14 -1: incrementExact +38 -1: (IIII)Lsun/util/calendar/CalendarDate; +8 -1: (II[BI)V +8 -1: isLocked +13 -1: ZoneInfo.java +36 -1: (Lsun/util/calendar/CalendarDate;J)V +35 -1: java/lang/invoke/MethodHandleImpl$1 +31 -1: (Ljava/util/Comparator<-TE;>;)V +19 -1: CharsetEncoder.java +52 -1: ()Ljava/util/Enumeration; +44 -1: (Ljava/io/InputStream;)Ljava/io/InputStream; +7 -1: field +5 -1: abort +25 -1: java/lang/SecurityManager +66 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesToDoubleTask +1316 -1: \xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe5\xa0\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\xa0\x80\xe4\x80\x8f\xe6\x80\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\xa0\x80\xe4\x80\x8f\xe6\x80\x80\xe4\x80\x8c\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xe2\xa0\x80\x18\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\x18\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xee\xa0\x80\x15\xee\xa0\x80\x16\xe6\xa0\x80\x18\xe2\x80\x80\x19\xe3\xa0\x80\x18\xe2\x80\x80\x14\xe3\xa0\x80\x18\xe3\xa0\x80\x18\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe3\xa0\x80\x18\xe6\xa0\x80\x18\xee\xa0\x80\x19\xe6\xa0\x80\x19\xee\xa0\x80\x19\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xee\xa0\x80\x15\xe6\xa0\x80\x18\xee\xa0\x80\x16\xe6\xa0\x80\x1b\xe6\xa0\x80\xe5\x80\x97\xe6\xa0\x80\x1b\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xee\xa0\x80\x15\xe6\xa0\x80\x19\xee\xa0\x80\x16\xe6\xa0\x80\x19\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe5\x80\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe3\xa0\x80\x0c\xe6\xa0\x80\x18\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\xe6\x80\x9a\xe6\xa0\x80\x1c\xe6\xa0\x80\x18\xe6\xa0\x80\x1b\xe6\xa0\x80\x1c\xc0\x80\xe7\x80\x85\xee\xa0\x80\x1d\xe6\xa0\x80\x19\xe4\xa0\x80\xe1\x80\x90\xe6\xa0\x80\x1c\xe6\xa0\x80\x1b\xe2\xa0\x80\x1c\xe2\xa0\x80\x19\xe1\xa0\x80\xd8\x8b\xe1\xa0\x80\xd8\x8b\xe6\xa0\x80\x1b\xdf\xbd\xe7\x80\x82\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xe6\xa0\x80\x1b\xe1\xa0\x80\xd4\x8b\xc0\x80\xe7\x80\x85\xee\xa0\x80\x1e\xe6\xa0\x80\xe0\xa0\x8b\xe6\xa0\x80\xe0\xa0\x8b\xe6\xa0\x80\xe0\xa0\x8b\xe6\xa0\x80\x18\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xe6\xa0\x80\x19\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xdf\xbd\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xe6\xa0\x80\x19\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xd8\x9d\xe7\x80\x82 +6 -1: (J[I)I +162 -1: (Ljava/util/List;Ljava/util/Collection;Ljava/util/Locale$FilteringMode;)Ljava/util/List; +21 -1: getQualifiedFieldName +46 -1: Ljava/util/Set;>; +47 -1: (Ljava/util/Collection;Ljava/util/Collection;)Z +10 -1: getRuntime +30 -1: threadLocalRandomSecondarySeed +18 -1: (Ljava/io/File;I)J +10 -1: methodName +34 -1: sun/reflect/generics/tree/TypeTree +35 -1: (Ljava/io/File;)[Ljava/lang/String; +31 -1: java/util/Collections$EmptyList +15 -1: LF_INVINTERFACE +9 -1: notifyAll +18 -1: (Ljava/io/File;I)V +94 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class<*>; +45 -1: (Ljava/lang/String;)Ljava/net/ContentHandler; +3 -1: enc +3 -1: end +18 -1: (Ljava/io/File;I)Z +47 -1: (Ljava/lang/Object;Ljava/lang/reflect/Method;)V +76 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Z)V +19 -1: getURLStreamHandler +46 -1: (Ljava/lang/ClassLoader;Ljava/lang/Class<*>;)V +17 -1: COMPILE_THRESHOLD +15 -1: charset is null +7 -1: ibm-912 +10 -1: basicTypes +7 -1: ibm-914 +78 -1: (Ljava/lang/Class;Ljava/lang/ref/SoftReference;Ljava/lang/ref/SoftReference;)Z +7 -1: ibm-915 +12 -1: JarFileEntry +12 -1: setThreshold +22 -1: (ILjava/lang/Object;)V +55 -1: Ljava/lang/Object; +16 -1: Unknown signal: +3 -1: zip +13 -1: CR_UNMAPPABLE +19 -1: getClassAtIfLoaded0 +21 -1: WindowsClientCounters +29 -1: Ljava/lang/invoke/MethodType; +91 -1: Ljava/util/Collections$UnmodifiableList;Ljava/util/RandomAccess; +23 -1: StackOverflowError.java +13 -1: Launcher.java +9 -1: Signature +7 -1: ibm-920 +153 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;ILjava/util/concurrent/ConcurrentHashMap$Node;)V +13 -1: setExtensions +26 -1: [Ljava/lang/ref/Reference; +7 -1: ibm-923 +12 -1: BMH.reinvoke +34 -1: java/lang/IllegalArgumentException +53 -1: (Ljava/lang/String;)Ljava/lang/NumberFormatException; +5 -1: .dirs +13 -1: finishToArray +22 -1: (ZI)Ljava/lang/String; +84 -1: (Ljava/lang/String;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/RuntimeException; +15 -1: charsetProvider +24 -1: ()Ljava/lang/Class; +10 -1: wordsInUse +26 -1: (Ljava/io/ExpiringCache;)I +53 -1: ()Ljava/util/Iterator;>; +25 -1: com/sun/management/GcInfo +26 -1: getCompatibilityExtensions +69 -1: (Ljava/lang/ref/ReferenceQueue;Ljava/util/concurrent/ConcurrentMap;)V +15 -1: getConstantPool +24 -1: [[Ljava/lang/Comparable; +26 -1: (Ljava/io/ExpiringCache;)V +8 -1: getTable +53 -1: sun/reflect/generics/repository/ConstructorRepository +5 -1: range +36 -1: (Ljava/lang/String;)Ljava/lang/Byte; +72 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;)V +60 -1: ([TT;TT;Ljava/util/Comparator<-TT;>;)I +20 -1: (Ljava/nio/Bits$1;)V +30 -1: ()Ljava/util/Spliterator; +6 -1: ([BB)I +53 -1: (Ljava/lang/ref/Finalizer;Lsun/misc/JavaLangAccess;)V +11 -1: memberTypes +45 -1: (ILjava/lang/String;)Ljava/lang/StringBuffer; +12 -1: OTHER_SYMBOL +65 -1: (Ljava/lang/Class;Ljava/lang/Class;)Ljava/lang/invoke/MethodType; +43 -1: (Ljava/util/Set;)[Ljava/lang/reflect/Field; +30 -1: (Ljava/lang/ref/Reference$1;)V +18 -1: GREGORIAN_INSTANCE +31 -1: Ljava/lang/FunctionalInterface; +57 -1: (Ljava/lang/Error;Ljava/lang/Exception;)Ljava/lang/Error; +54 -1: ([Ljava/lang/reflect/Field;)[Ljava/lang/reflect/Field; +14 -1: not an array: +6 -1: ([BB)V +9 -1: ISO8859_1 +8 -1: addTrans +27 -1: getFunctionalInterfaceClass +29 -1: lambda$comparingInt$7b0bb60$1 +8 -1: TreeNode +138 -1: Ljava/util/Dictionary;Ljava/util/Map;Ljava/lang/Cloneable;Ljava/io/Serializable; +3 -1: era +22 -1: fakeMethodHandleInvoke +9 -1: addToList +39 -1: (Ljava/lang/Class;[Ljava/lang/String;)V +17 -1: launchApplication +21 -1: randomNumberGenerator +51 -1: Ljava/lang/ThreadLocal;>; +35 -1: java/io/ObjectOutputStream$PutField +42 -1: (ILjava/util/function/IntBinaryOperator;)I +3 -1: err +13 -1: cachedDecoder +32 -1: sun/util/calendar/ZoneInfoFile$1 +23 -1: doIntersectionPrivilege +19 -1: cspc850multilingual +56 -1: Ljava/util/Map;[Ljava/lang/String;>; +11 -1: loader_data +27 -1: (Ljava/util/jar/Manifest;)V +5 -1: files +90 -1: Ljava/util/concurrent/ConcurrentMap; +36 -1: [[Ljava/lang/invoke/LambdaForm$Name; +5 -1: lines +55 -1: (Lsun/misc/URLClassPath$JarLoader;)Lsun/misc/MetaIndex; +9 -1: ansi-1251 +15 -1: refKindIsMethod +29 -1: java/lang/reflect/Constructor +3 -1: est +19 -1: Lsun/misc/Launcher; +109 -1: (Ljava/security/PrivilegedExceptionAction;Ljava/security/AccessControlContext;)TT; +10 -1: getOffsets +9 -1: removeAll +23 -1: java/util/regex/Matcher +8 -1: sumCount +7 -1: implies +10 -1: MAIN_CLASS +75 -1: (Ljava/util/List;)[Ljava/lang/String; +11 -1: getISO3Code +4 -1: high +53 -1: (TK;Ljava/util/function/BiFunction<-TK;-TV;+TV;>;)TV; +17 -1: setNormalizedDate +23 -1: AbstractRepository.java +28 -1: java/util/LinkedList$ListItr +8 -1: isFrozen +38 -1: (Ljava/lang/String;Z)Ljava/lang/Class; +16 -1: ReflectUtil.java +30 -1: ()Ljava/util/stream/IntStream; +57 -1: (Ljava/lang/Object;JLjava/lang/Object;)Ljava/lang/Object; +11 -1: getResource +16 -1: ThreadDeath.java +24 -1: unmodifiableNavigableSet +59 -1: (Ljava/lang/String;)Ljava/util/Enumeration; +24 -1: java.security.auth.debug +58 -1: (Ljava/io/FileInputStream;)Ljava/nio/channels/FileChannel; +25 -1: ()Ljava/util/Enumeration; +11 -1: getInstance +6 -1: MONDAY +15 -1: jdkMinorVersion +16 -1: newThreadWithAcc +6 -1: CENHOW +32 -1: Max. Heap Size (Estimated): +61 -1: (Ljava/lang/invoke/MethodType;Z)Ljava/lang/invoke/LambdaForm; +11 -1: windows-932 +7 -1: Index: +11 -1: composeList +6 -1: utf-16 +6 -1: ibm437 +10 -1: getJarFile +8 -1: , rem = +13 -1: multiNewArray +14 -1: getDefaultPort +39 -1: Ljava/security/cert/CertificateFactory; +10 -1: L_RESERVED +19 -1: getMethodAtIfLoaded +8 -1: needCast +8 -1: IS_FIELD +15 -1: ClassValue.java +31 -1: ()Ljava/util/function/Supplier; +125 -1: (Ljava/lang/Class<*>;)Ljava/util/Map;Ljava/lang/annotation/Annotation;>; +34 -1: lambda$comparingByValue$827a17d5$1 +4 -1: NONE +21 -1: java/nio/DoubleBuffer +33 -1: ()Lsun/reflect/LangReflectAccess; +26 -1: invalid compression method +6 -1: (TK;)Z +16 -1: FT_UNCHECKED_REF +14 -1: getGenericType +17 -1: pathSeparatorChar +8 -1: writeUTF +8 -1: NO_PROXY +188 -1: (Ljava/lang/String;Ljava/util/Map;Ljava/util/Map;Ljava/util/Map;)V +13 -1: finalRefCount +12 -1: NF_checkCast +6 -1: utf-32 +26 -1: (Ljava/util/ArrayDeque;I)Z +19 -1: prefetchWriteStatic +14 -1: computeInvoker +5 -1: cap= +19 -1: generateCertificate +15 -1: methodModifiers +3 -1: exc +27 -1: ()Lsun/misc/JavaLangAccess; +5 -1: State +14 -1: NullComparator +10 -1: getClassAt +15 -1: printProperties +110 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B)Ljava/lang/reflect/Constructor; +40 -1: (Ljava/util/List<*>;Ljava/util/Random;)V +63 -1: ()[Ljava/lang/reflect/TypeVariable; +28 -1: (I)Ljava/lang/StringBuilder; +48 -1: ([DIILjava/util/function/DoubleBinaryOperator;)V +3 -1: exp +11 -1: interpret_L +17 -1: Serializable.java +8 -1: FJDouble +12 -1: HashMap.java +9 -1: sys_paths +17 -1: getMainAttributes +14 -1: asDoubleBuffer +10 -1: buildNames +26 -1: TOPLEVEL_WINDOW_PERMISSION +4 -1: Type +31 -1: (Ljava/util/Collection<+TE;>;)V +64 -1: (Ljava/lang/String;ZLjava/lang/ClassLoader;)Ljava/lang/Class<*>; +100 -1: (Ljava/util/Collection;Ljava/lang/Class;)Ljava/util/Collection; +10 -1: checkError +31 -1: (Ljava/util/Collection<+TE;>;)Z +31 -1: java/lang/NoSuchMethodException +6 -1: attach +87 -1: (BLjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle; +9 -1: writeChar +44 -1: java/util/ArraysParallelSortHelpers$FJObject +34 -1: (Ljava/lang/Class;Ljava/io/File;)Z +21 -1: java/util/zip/ZipFile +5 -1: dirty +6 -1: (JIZ)V +12 -1: leftoverChar +39 -1: is being loaded in another classloader +10 -1: writeBytes +6 -1: unlink +41 -1: (TT;Ljava/lang/ref/ReferenceQueue;)V +21 -1: getBootstrapResources +95 -1: Ljava/util/AbstractMap;Ljava/io/Serializable; +10 -1: PathStatus +25 -1: java/io/InputStreamReader +15 -1: ISO_8859-9:1989 +37 -1: java/lang/ExceptionInInitializerError +14 -1: exceptionTypes +19 -1: BufferedReader.java +34 -1: Could not create SecurityManager: +13 -1: definePackage +12 -1: getAndAddInt +50 -1: (Ljava/lang/Class;)Ljava/lang/invoke/MethodHandle; +30 -1: (Ljava/lang/SecurityManager;)V +12 -1: fxLaunchName +22 -1: BINARYSEARCH_THRESHOLD +29 -1: JVMTI_THREAD_STATE_TERMINATED +9 -1: fullFence +60 -1: (Ljava/lang/String;Z)Ljava/util/Enumeration; +29 -1: java/lang/Thread$WeakClassKey +47 -1: (Ljava/nio/charset/Charset;Ljava/lang/String;)V +8 -1: (TV;)TV; +60 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;I)V +47 -1: java/security/cert/CertificateEncodingException +12 -1: BA_DIRECTORY +53 -1: (Ljava/lang/Class;ZLjava/lang/Class;)Ljava/util/List; +9 -1: checkRead +6 -1: +4 -1: args +17 -1: genericMethodType +10 -1: writeFloat +26 -1: Can't handle static method +49 -1: (Ljava/lang/String;)Ljava/lang/invoke/MethodType; +22 -1: MapReduceKeysToIntTask +17 -1: jvm_micro_version +29 -1: (Ljava/util/Map<+TK;+TV;>;Z)V +40 -1: ([Ljava/lang/Object;Ljava/lang/Object;)I +7 -1: vmindex +22 -1: maybeCompileToBytecode +89 -1: Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl; +11 -1: getLauncher +17 -1: jvm_major_version +36 -1: ([IIII)Ljava/util/Spliterator$OfInt; +40 -1: ([Ljava/lang/Object;Ljava/lang/Object;)V +33 -1: IllegalMonitorStateException.java +73 -1: ([ILjava/util/function/IntUnaryOperator;)Ljava/util/function/IntConsumer; +39 -1: (Ljava/lang/String;)Ljava/lang/Package; +29 -1: java/lang/CharacterDataLatin1 +52 -1: (Ljava/lang/annotation/Annotation;)Ljava/lang/Class; +49 -1: (Ljava/lang/CharSequence;II)Ljava/nio/CharBuffer; +53 -1: (Ljava/lang/Object;)Ljava/nio/charset/CharsetDecoder; +22 -1: Ljava/net/FileNameMap; +16 -1: isAnonymousClass +4 -1: item +7 -1: compute +12 -1: user.country +22 -1: malformed context url: +16 -1: jvm_build_number +69 -1: (Ljava/lang/ThreadLocal;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry; +17 -1: getDirectionality +4 -1: save +8 -1: UNMARKED +58 -1: (Ljava/lang/String;Ljava/lang/Object;[Ljava/lang/Object;)V +12 -1: searchFields +9 -1: frequency +23 -1: getLocalizedInputStream +2 -1: +126 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;ILjava/lang/Class<*>;)Ljava/util/List; +39 -1: (Ljava/lang/String;Z)Ljava/lang/String; +7 -1: setZone +2 -1: " +9 -1: checkRef( +11 -1: loadFromXML +49 -1: (Ljava/util/jar/JarFile;Ljava/util/Enumeration;)V +68 -1: (IILsun/util/calendar/CalendarDate;)Lsun/util/calendar/CalendarDate; +2 -1: ( +54 -1: (Ljava/util/TimeZone;)Lsun/util/calendar/CalendarDate; +6 -1: rewind +13 -1: getAndSetLong +30 -1: java/lang/invoke/MethodHandles +11 -1: ListPattern +97 -1: Ljava/util/AbstractList;Ljava/util/RandomAccess;Ljava/io/Serializable; +25 -1: (Ljava/io/InputStream;I)V +9 -1: setMethod +10 -1: H_REG_NAME +39 -1: ([Ljava/lang/Object;)Ljava/lang/Object; +16 -1: AbstractMap.java +68 -1: Ljava/util/Hashtable; +58 -1: (Ljava/lang/String;[Ljava/lang/String;)Ljava/lang/Process; +23 -1: getFileSystemAttributes +12 -1: toSurrogates +2 -1: !/ +5 -1: empty +24 -1: isUnicodeIdentifierStart +35 -1: sun/nio/cs/StandardCharsets$Classes +27 -1: [Ljava/security/Permission; +13 -1: getDefinition +11 -1: permission= +42 -1: (ILjava/lang/String;)Ljava/nio/ByteBuffer; +69 -1: (Ljava/util/List;>;)Ljava/lang/invoke/MethodType; +3 1: zzz +17 -1: hasLongPrimitives +2 -1: != +13 -1: getInterfaces +2 -1: " +11 -1: noInflation +14 -1: aliases_UTF_16 +2 -1: ") +17 -1: ()Ljava/util/Map; +55 -1: ()Ljava/util/Map; +6 -1: charAt +12 -1: getStringAt0 +10 -1: superClone +28 -1: Ljava/util/AbstractSet; +40 -1: java/lang/ref/Reference$ReferenceHandler +22 -1: NaturalOrderComparator +9 -1: markValue +9 -1: getRegion +26 -1: null permissions parameter +17 -1: Ljava/util/Stack; +14 -1: codebase= +36 -1: (Ljava/util/List;)Ljava/lang/Object; +17 -1: setJavaLangAccess +16 -1: hasQueuedThreads +5 -1: (CC)I +8 -1: toString +5 -1: (CC)J +11 -1: permissions +10 -1: getHeaders +27 -1: java/io/BufferedInputStream +21 -1: unicodelittleunmarked +51 -1: (Ljava/net/URLClassLoader;Ljava/util/Enumeration;)V +14 -1: generateMethod +11 -1: skipForward +55 -1: java/util/concurrent/ConcurrentHashMap$ForEachEntryTask +5 -1: (CC)Z +15 -1: getURLClassPath +84 -1: Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet; +23 -1: primitiveParameterCount +8 -1: security +14 -1: aliases_UTF_32 +22 -1: ()Ljava/util/Set; +9 -1: listFiles +15 -1: insertElementAt +42 -1: Ljava/util/Comparator; +11 -1: getUserInfo +46 -1: ([JIILjava/util/function/LongBinaryOperator;)V +23 -1: (Ljava/util/Iterator;)V +46 -1: ([Ljava/lang/Object;II)Ljava/util/Spliterator; +67 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Object;)Ljava/lang/Object; +14 -1: normalizeMonth +13 -1: getStackTrace +51 -1: java/lang/invoke/MethodType$ConcurrentWeakInternSet +8 -1: makeChar +2 -1: %% +9 -1: getTarget +21 -1: packageDefinitionLock +52 -1: java/util/concurrent/ConcurrentHashMap$ValueIterator +12 -1: OTHER_NUMBER +22 -1: java/util/jar/JarEntry +11 -1: access$1000 +16 -1: NON_SPACING_MARK +13 -1: last-modified +68 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction; +16 -1: Australia/Darwin +55 -1: (Ljava/lang/management/ThreadInfo;[Ljava/lang/Object;)V +29 -1: Ljava/lang/ref/WeakReference; +19 -1: expungeStaleEntries +41 -1: Ljava/security/PrivilegedActionException; +6 -1: update +23 -1: (Ljava/lang/Object;JB)V +10 -1: newUpdater +39 -1: (Ljava/net/URL;)Ljava/util/jar/JarFile; +25 -1: Ljava/net/ContentHandler; +21 -1: ARRAY_INT_INDEX_SCALE +13 -1: hasSurrogates +27 -1: (Ljava/lang/ThreadGroup;Z)Z +20 -1: createGCNotification +21 -1: negative day of week +11 -1: getInIfOpen +22 -1: java/util/RandomAccess +24 -1: available locales = +21 -1: AccessController.java +44 -1: can not access a protected member of class +4 -1: LONG +15 -1: objectOnlyTypes +75 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetDecoder;)V +14 -1: getFindClasses +10 -1: storeFence +16 -1: asNormalOriginal +45 -1: (Ljava/lang/String;)Ljava/lang/StringBuilder; +6 -1: millis +16 -1: America/St_Johns +38 -1: ()Ljava/lang/IllegalArgumentException; +37 -1: DIRECTIONALITY_POP_DIRECTIONAL_FORMAT +15 -1: implReplaceWith +29 -1: ([C)Ljava/lang/StringBuilder; +15 -1: Appendable.java +41 -1: (Ljava/lang/String;)Ljava/io/InputStream; +26 -1: Illegal Initial Capacity: +9 -1: checkBase +7 -1: setYear +15 -1: DISPLAY_VARIANT +7 -1: getType +31 -1: Ljava/lang/ref/Reference<+TT;>; +15 -1: isFieldOrMethod +35 -1: appendToClassPathForInstrumentation +16 -1: LocaleNameGetter +7 -1: compact +55 -1: ()Ljava/util/Map; +10 -1: dummyQueue +3 -1: ROC +2 -1: (" +15 -1: checkPermission +38 -1: java/util/zip/ZipFile$ZipEntryIterator +8 -1: hexDigit +8 -1: pairs: +2 -1: () +2 -1: )\n +43 -1: handler for url different from this handler +15 -1: isAutoDetecting +37 -1: (Ljava/util/LinkedList$Node;)TE; +11 -1: Unsafe.java +12 -1: windows-1250 +39 -1: java/util/Collections$CheckedCollection +12 -1: windows-1251 +15 -1: codePointAtImpl +12 -1: windows-1252 +12 -1: windows-1253 +12 -1: windows-1254 +58 -1: (Ljava/lang/String;Ljava/lang/Integer;)Ljava/lang/Integer; +5 -1: deref +12 -1: windows-1255 +12 -1: windows-1256 +12 -1: windows-1257 +12 -1: windows-1258 +14 -1: FT_CHECKED_REF +47 -1: (Ljava/util/Hashtable;Ljava/util/Hashtable$1;)V +37 -1: (J)Lsun/util/calendar/Gregorian$Date; +19 -1: checkPropertyAccess +4 -1: file +17 -1: emptyListIterator +26 -1: sun/util/calendar/ZoneInfo +14 -1: file.separator +4 -1: fill +62 -1: (Ljava/util/Spliterator$OfLong;Z)Ljava/util/stream/LongStream; +18 -1: java/util/Iterator +20 -1: reduceValuesToDouble +12 -1: LF_CS_LINKER +26 -1: java/util/Arrays$ArrayList +45 -1: Ljava/util/concurrent/ConcurrentHashMap$Node; +6 -1: skipLF +2 -1: )= +39 -1: (I[Ljava/lang/invoke/LambdaForm$Name;)I +90 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;)V +18 -1: parameterModifiers +31 -1: (Ljava/util/Collection<+TK;>;)Z +21 -1: proxy can not be null +22 -1: java/io/FileDescriptor +6 -1: Loader +21 -1: numberOfTrailingZeros +10 -1: addMapping +39 -1: (I[Ljava/lang/invoke/LambdaForm$Name;)Z +30 -1: java/util/Locale$LanguageRange +20 -1: getReflectionFactory +16 -1: shouldMeterInput +56 -1: ([Ljava/lang/reflect/Method;)[Ljava/lang/reflect/Method; +23 -1: sun/net/ProgressMonitor +510 -1: \xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\x01\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\x01\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80 +28 -1: java/util/Spliterator$OfLong +24 -1: SynchronizedNavigableMap +4 -1: find +6 -1: unsafe +31 -1: java/nio/ByteBufferAsIntBufferB +2 -1: ,\n +6 -1: [ call +14 -1: registerFilter +10 -1: ValuesView +9 -1: untreeify +59 -1: ([Ljava/lang/Object;IILjava/util/function/BinaryOperator;)V +13 -1: getSimpleName +41 -1: (Ljava/util/Vector;Ljava/util/Vector$1;)V +31 -1: java/nio/ByteBufferAsIntBufferL +45 -1: (Ljava/lang/reflect/Field;)Ljava/lang/Object; +13 -1: getDefaultRef +18 -1: mapAlternativeName +30 -1: setDefaultAllowUserInteraction +13 -1: cannotCastMsg +4 -1: )=>{ +7 -1: println +2 -1: , +70 -1: (Ljava/nio/Buffer;IILjava/nio/Buffer;II)Ljava/nio/charset/CoderResult; +32 -1: (ILjava/util/Collection<+TE;>;)Z +9 -1: interpret +104 -1: (Ljava/util/NavigableSet;Ljava/lang/Class;)Ljava/util/NavigableSet; +7 -1: advance +86 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction; +11 -1: Stack trace +6 -1: raise0 +68 -1: ()Ljava/util/Collections$UnmodifiableNavigableMap$EmptyNavigableMap; +32 -1: sun/util/calendar/Gregorian$Date +33 -1: java/lang/ref/ReferenceQueue$Lock +19 -1: constructorAccessor +6 -1: IBM367 +18 -1: CharacterData.java +8 -1: parseURL +32 -1: java/io/FilePermissionCollection +7 -1: ([JI)[J +9 -1: JIS_X0201 +2 -1: -1 +8 -1: encoding +63 -1: ([Ljava/util/WeakHashMap$Entry;[Ljava/util/WeakHashMap$Entry;)V +9 -1: localhost +66 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal$1;)V +54 -1: (II[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType; +67 -1: (Ljava/lang/Class;Ljava/lang/Class;)Ljava/lang/invoke/MethodHandle; +14 -1: containsAllPDs +23 -1: setAllowUserInteraction +30 -1: Ljava/security/DomainCombiner; +26 -1: Ljava/security/Permission; +30 -1: serializePropertiesToByteArray +112 -1: (Ljava/util/Iterator;Ljava/util/Map;)V +2 -1: .. +6 -1: LOCEXT +2 -1: ./ +26 -1: (Ljava/nio/ByteBuffer;II)V +18 -1: (Ljava/io/File;J)Z +45 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;)V +17 -1: asCollectorChecks +7 -1: actions +5 -1: ([I)I +20 -1: asChange_otherthread +20 -1: forInputStreamReader +69 -1: java/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject +5 -1: FINAL +17 -1: staticPermissions +44 -1: (Ljava/lang/Object;)Ljava/lang/StringBuffer; +5 -1: ([I)V +4 -1: swap +10 -1: readOffset +2 -1: /* +112 -1: (JLjava/util/function/Function<-TK;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU; +12 -1: isAsciiDigit +2 -1: /- +2 -1: /. +2 -1: // +5 -1: zones +37 -1: (ILjava/lang/Object;)Ljava/util/List; +17 -1: SHUFFLE_THRESHOLD +32 -1: java/lang/CharacterDataUndefined +23 -1: sun.reflect.noInflation +11 -1: Can not set +36 -1: (Ljava/util/Properties$LineReader;)V +9 -1: debugName +78 -1: (Ljava/util/HashMap$Node;Ljava/util/HashMap$Node;)Ljava/util/HashMap$TreeNode; +6 -1: (III)J +58 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/lang/String; +19 -1: BufferedWriter.java +148 -1: (Ljava/lang/Class;[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B)Ljava/lang/reflect/Constructor; +6 -1: printf +7 -1: signers +2 -1: 0. +4 -1: Date +15 -1: findReplacement +6 -1: (III)V +32 -1: java/nio/ReadOnlyBufferException +92 -1: ([Ljava/lang/String;)Ljava/util/Map;>; +6 -1: (III)Z +43 -1: (Ljava/lang/ClassValue;Ljava/lang/Object;)V +32 -1: java/nio/ByteBufferAsLongBufferB +16 -1: Constructor.java +10 -1: removeLast +9 -1: ([CII[B)I +40 -1: ()Ljava/util/List;>; +2 -1: 1. +7 -1: VARARGS +32 -1: java/nio/ByteBufferAsLongBufferL +18 -1: java/lang/Shutdown +40 -1: not supported, using ISO-8859-1 instead +40 -1: Ljava/util/Collections$EmptyEnumeration; +146 -1: (Ljava/util/SortedMap;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/SortedMap; +20 -1: aliases_UTF_32LE_BOM +23 -1: getEnclosingConstructor +2 -1: 0X +11 -1: NO_TIMEZONE +37 -1: ()Lsun/misc/JavaNioAccess$BufferPool; +18 -1: printXUsageMessage +9 -1: isPrivate +63 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/invoke/MethodHandle;)V +17 -1: maxSkipBufferSize +76 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetEncoder;)V +40 -1: (Ljava/lang/String;II)Ljava/lang/String; +17 -1: selectAlternative +53 -1: [Ljava/util/concurrent/ConcurrentHashMap$CounterCell; +87 -1: (Ljava/util/function/Supplier<+TS;>;)Ljava/lang/ThreadLocal; +40 -1: Ljava/util/concurrent/ConcurrentHashMap; +41 -1: (Ljava/lang/Character;)Ljava/lang/String; +19 -1: getMemberRefInfoAt0 +14 -1: reduceToDouble +18 -1: SUPPRESSED_CAPTION +6 -1: CANADA +64 -1: (IZ[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Ljava/lang/String; +12 -1: UnicodeBlock +2 -1: 0x +44 -1: (Ljava/lang/CharSequence;II)Ljava/io/Writer; +23 -1: getPermissionCollection +19 -1: threadLocalHashCode +9 -1: createMap +25 -1: checkForSpecialAttributes +12 -1: Mark invalid +36 -1: java/lang/CharSequence$1CharIterator +11 -1: local time +16 -1: Enumeration.java +27 -1: (Ljava/util/zip/ZipEntry;)V +11 -1: MATH_SYMBOL +8 -1: filename +24 -1: (Ljava/util/List<*>;II)V +9 -1: bindCache +18 -1: java/io/FileFilter +12 -1: checkInvoker +18 -1: OSEnvironment.java +8 -1: EmptyMap +11 -1: getIterator +35 -1: java/util/function/IntUnaryOperator +35 -1: java/util/WeakHashMap$EntryIterator +90 -1: (Ljava/util/Queue;Ljava/lang/Class;)Ljava/util/Queue; +8 -1: batchFor +16 -1: isValidCodePoint +27 -1: ([Lsun/util/calendar/Era;)V +16 -1: ThreadGroup.java +33 2: sun/net/www/protocol/file/Handler +7 -1: isField +22 -1: sun/misc/OSEnvironment +38 -1: Ljava/lang/Class; +12 -1: ADDRESS_SIZE +8 -1: forDigit +49 -1: (Ljava/lang/Object;)Ljava/util/WeakHashMap$Entry; +13 -1: getCodeSource +41 -1: ([Ljava/lang/Class<*>;)Ljava/lang/String; +39 -1: (Ljava/util/function/Predicate<-TE;>;)Z +13 -1: asFloatBuffer +34 -1: ()Lsun/reflect/generics/tree/Tree; +3 -1: ftp +18 -1: maybeReBoxElements +82 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)[[Ljava/lang/annotation/Annotation; +48 -1: ()Ljava/util/Set;>; +27 -1: (Ljava/util/NavigableMap;)V +18 -1: parameterSlotCount +20 -1: NF_getCallSiteTarget +16 -1: aliases_US_ASCII +13 -1: NF_staticBase +31 -1: sun/reflect/ConstructorAccessor +26 -1: guessContentTypeFromStream +10 -1: Deprecated +35 -1: System initialization has completed +11 -1: initialized +7 -1: compare +15 -1: maxDirectMemory +19 -1: setLastModifiedTime +7 -1: (J[BZ)J +12 -1: readEpochSec +66 -1: (Ljava/lang/String;Ljava/lang/String;)Lsun/util/locale/BaseLocale; +69 -1: ()Lsun/misc/JavaSecurityProtectionDomainAccess$ProtectionDomainCache; +9 -1: Constants +11 -1: valueOffset +62 -1: (Ljava/util/Hashtable;)V +33 -1: java/lang/CharacterDataPrivateUse +21 -1: Exception in thread " +40 -1: ()Ljava/util/Set; +12 -1: Asia/Yerevan +40 -1: (Ljava/lang/Throwable;)Ljava/lang/Error; +25 -1: (IS)Ljava/nio/ByteBuffer; +7 -1: (I[CI)I +45 -1: java/nio/charset/UnmappableCharacterException +23 -1: java/util/WeakHashMap$1 +21 -1: setFXLaunchParameters +1250 -1: ADANDAEAREAFAFGAGATGAIAIAALALBAMARMANANTAOAGOAQATAARARGASASMATAUTAUAUSAWABWAXALAAZAZEBABIHBBBRBBDBGDBEBELBFBFABGBGRBHBHRBIBDIBJBENBLBLMBMBMUBNBRNBOBOLBQBESBRBRABSBHSBTBTNBVBVTBWBWABYBLRBZBLZCACANCCCCKCDCODCFCAFCGCOGCHCHECICIVCKCOKCLCHLCMCMRCNCHNCOCOLCRCRICUCUBCVCPVCWCUWCXCXRCYCYPCZCZEDEDEUDJDJIDKDNKDMDMADODOMDZDZAECECUEEESTEGEGYEHESHERERIESESPETETHFIFINFJFJIFKFLKFMFSMFOFROFRFRAGAGABGBGBRGDGRDGEGEOGFGUFGGGGYGHGHAGIGIBGLGRLGMGMBGNGINGPGLPGQGNQGRGRCGSSGSGTGTMGUGUMGWGNBGYGUYHKHKGHMHMDHNHNDHRHRVHTHTIHUHUNIDIDNIEIRLILISRIMIMNININDIOIOTIQIRQIRIRNISISLITITAJEJEYJMJAMJOJORJPJPNKEKENKGKGZKHKHMKIKIRKMCOMKNKNAKPPRKKRKORKWKWTKYCYMKZKAZLALAOLBLBNLCLCALILIELKLKALRLBRLSLSOLTLTULULUXLVLVALYLBYMAMARMCMCOMDMDAMEMNEMFMAFMGMDGMHMHLMKMKDMLMLIMMMMRMNMNGMOMACMPMNPMQMTQMRMRTMSMSRMTMLTMUMUSMVMDVMWMWIMXMEXMYMYSMZMOZNANAMNCNCLNENERNFNFKNGNGANINICNLNLDNONORNPNPLNRNRUNUNIUNZNZLOMOMNPAPANPEPERPFPYFPGPNGPHPHLPKPAKPLPOLPMSPMPNPCNPRPRIPSPSEPTPRTPWPLWPYPRYQAQATREREUROROURSSRBRURUSRWRWASASAUSBSLBSCSYCSDSDNSESWESGSGPSHSHNSISVNSJSJMSKSVKSLSLESMSMRSNSENSOSOMSRSURSSSSDSTSTPSVSLVSXSXMSYSYRSZSWZTCTCATDTCDTFATFTGTGOTHTHATJTJKTKTKLTLTLSTMTKMTNTUNTOTONTRTURTTTTOTVTUVTWTWNTZTZAUAUKRUGUGAUMUMIUSUSAUYURYUZUZBVAVATVCVCTVEVENVGVGBVIVIRVNVNMVUVUTWFWLFWSWSMYEYEMYTMYTZAZAFZMZMBZWZWE +60 -1: Ljava/util/Set;>; +24 -1: ()Ljava/security/Policy; +7 -1: initted +44 -1: java/util/Collections$UnmodifiableCollection +12 -1: Pacific/Apia +23 -1: checkProxyPackageAccess +7 -1: (I[CI)V +64 -1: ([Ljava/lang/Object;IILjava/lang/Object;Ljava/util/Comparator;)I +16 -1: getJavaNioAccess +7 -1: reverse +7 -1: nocerts +16 -1: activeGroupCount +34 -1: java/util/jar/JarFile$JarFileEntry +7 -1: loaders +9 -1: toRadians +24 -1: java/util/HashMap$KeySet +37 -1: (Ljava/lang/Class;)Ljava/lang/Object; +6 -1: getRef +6 -1: H_DASH +17 -1: LinkageError.java +66 -1: (Ljava/lang/invoke/MethodTypeForm;)Ljava/lang/invoke/MethodHandle; +41 -1: (Ljava/nio/ByteBuffer;)Ljava/util/BitSet; +10 -1: addMinutes +58 -1: ([TT;II)Ljava/util/Spliterator; +9 -1: parseJars +13 -1: getUnsignedCS +28 -1: (Ljava/util/AbstractList;I)V +22 -1: threadLocalRandomProbe +19 -1: newDirectByteBuffer +27 -1: Filter already registered: +8 -1: unescape +31 -1: sun/misc/URLClassPath$JarLoader +6 -1: TAIWAN +53 -1: ()Ljava/util/ListIterator; +17 -1: REVERSE_THRESHOLD +31 -1: Java(TM) SE Runtime Environment +7 -1: SECONDS +70 -1: (Ljava/util/function/ToLongFunction<-TT;>;)Ljava/util/Comparator; +7 -1: BLOCKED +6 -1: Caches +63 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodHandle;)V +2 -1: : +210 -1: (Ljava/util/Map;Ljava/lang/annotation/Annotation;>;Ljava/util/Map;Ljava/lang/annotation/Annotation;>;I)V +153 -1: (JLjava/util/function/BiFunction;Ljava/util/Map$Entry;+Ljava/util/Map$Entry;>;)Ljava/util/Map$Entry; +22 -1: ()Ljava/lang/Class<*>; +28 -1: Ljava/lang/OutOfMemoryError; +19 -1: writeFileDescriptor +39 -1: Ljava/util/LinkedHashMap$Entry; +26 -1: (ILjava/util/Collection;)Z +18 -1: getEncodedInternal +16 -1: ForEachValueTask +23 -1: (Ljava/util/List<*>;I)V +19 -1: SharedArchiveLoader +20 -1: probeBackupLocations +24 -1: java/lang/StringCoding$1 +28 -1: lookupContentHandlerClassFor +36 -1: ()Lsun/misc/Launcher$ExtClassLoader; +27 -1: reflectionFactoryAccessPerm +14 -1: ACCESSOR_FORMS +35 -1: ([JII)Ljava/util/stream/LongStream; +34 -1: ISO-8859-1 charset not available: +8 -1: cscesu-8 +2 -1: ;/ +17 -1: typeToPackageName +34 -1: (Ljava/net/URL;)Ljava/lang/String; +5 -1: (IZ)V +25 -1: Prohibited package name: +51 -1: (Ljava/lang/Object;Ljava/lang/ref/ReferenceQueue;)V +108 -1: (JLjava/util/function/ToIntFunction;>;ILjava/util/function/IntBinaryOperator;)I +12 -1: soleInstance +27 -1: (Ljava/io/BufferedReader;)V +71 -1: (Ljava/nio/charset/CodingErrorAction;)Ljava/nio/charset/CharsetDecoder; +17 -1: Ljava/lang/Class; +38 -1: (Ljava/lang/String;)Ljava/lang/Double; +10 -1: viewAsType +22 -1: (Ljava/io/DataInput;)I +22 -1: (Ljava/io/DataInput;)J +105 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/WrongMethodTypeException; +16 -1: setJavaNetAccess +73 -1: (ILjava/lang/Object;Ljava/lang/Object;ZZ)Ljava/util/HashMap$Node; +22 -1: (Ljava/io/DataInput;)V +14 -1: getHostAddress +37 -1: sun/reflect/annotation/TypeAnnotation +14 -1: ENCLOSING_MARK +5 -1: FALSE +14 -1: preDefineClass +9 -1: newKeySet +18 -1: getWaitQueueLength +32 -1: ()Lsun/misc/URLClassPath$Loader; +54 -1: (Ljava/nio/CharBuffer;I)Ljava/nio/charset/CoderResult; +3 -1: SEP +45 -1: (ITK;TV;Ljava/util/Hashtable$Entry;)V +17 -1: getDeclaredFields +7 -1: getDate +10 -1: getClasses +240 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesToIntTask;Ljava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)V +12 -1: WeakClassKey +14 -1: LF_GEN_INVOKER +25 -1: Ljava/lang/StringBuilder; +2 -1: > +9 -1: getJarMap +4 -1: asin +37 -1: (Ljava/net/URLStreamHandlerFactory;)V +30 -1: not a constructor type or name +4 -1: main +22 -1: java/io/FilenameFilter +22 -1: sun.java.launcher.diag +30 -1: ()Ljava/util/Spliterator; +57 -1: ;>(Ljava/util/List;)V +86 -1: (Ljava/lang/ThreadLocal;>;)TT; +18 -1: canBeCalledVirtual +9 -1: Shift_JIS +24 -1: ()Ljava/util/ArrayDeque; +32 -1: (Ljava/lang/Class$MethodArray;)V +22 -1: java/lang/StringCoding +33 -1: sun/util/locale/LocaleObjectCache +20 -1: Sorry, deque too big +38 -1: java/lang/Throwable$WrappedPrintWriter +25 -1: (Ljava/io/InputStream;J)J +44 -1: (Ljava/security/Permission;)Ljava/util/List; +5 -1: thunk +5 -1: props +15 -1: getLastModified +120 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/util/HashMap;>;)V +146 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MemberName;Ljava/lang/Class;Ljava/lang/invoke/MethodHandleImpl$1;)V +27 -1: parseExtensionsDependencies +10 -1: getRawType +39 -1: (Ljava/nio/charset/CodingErrorAction;)V +22 -1: ObjectStreamField.java +6 -1: handle +11 -1: hasPrevious +18 -1: instanceof Float: +52 -1: (ZLjava/io/OutputStream;Ljava/nio/charset/Charset;)V +4 -1: make +13 -1: isIdeographic +26 -1: java/util/HashMap$EntrySet +51 -1: (Ljava/util/Hashtable;)[Ljava/util/Hashtable$Entry; +91 -1: (Ljava/lang/CharSequence;Ljava/lang/Iterable<+Ljava/lang/CharSequence;>;)Ljava/lang/String; +13 -1: makeAllocator +10 -1: , headless +20 -1: expungeStaleElements +58 -1: sun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget +41 -1: ([Ljava/lang/Object;Ljava/lang/Class$1;)V +50 -1: (I)Ljava/util/Iterator; +7 -1: TreeBin +21 -1: Ljava/io/IOException; +56 -1: (I[Ljava/lang/Class;)[Ljava/lang/invoke/LambdaForm$Name; +6 -1: LOCFLG +6 -1: DIRECT +3 -1: SIG +37 -1: java/security/NoSuchProviderException +39 -1: " with illegal data type conversion to +16 -1: getCodeSourceURL +51 -1: java/util/concurrent/ConcurrentHashMap$EntrySetView +47 -1: (Ljava/util/ArrayList;Ljava/util/ArrayList$1;)V +6 -1: delete +38 -1: sun/reflect/UnsafeFieldAccessorFactory +11 -1: isDestroyed +140 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;ILjava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$Node;)Z +9 -1: unaligned +36 -1: ()Lsun/misc/Launcher$AppClassLoader; +57 -1: (Ljava/lang/String;Ljava/util/Locale;)[Ljava/lang/String; +37 -1: sun/reflect/annotation/AnnotationType +49 -1: ([TT;)Ljava/util/List; +24 -1: (S)Ljava/nio/ByteBuffer; +6 -1: ([DD)I +9 -1: setTarget +29 -1: (IF)Ljava/lang/StringBuilder; +12 -1: forBasicType +10 -1: (IIII[BI)V +8 -1: ([DIID)I +9 -1: BASE_YEAR +19 -1: ()Ljava/lang/Error; +42 -1: (Ljava/util/Map;)V +6 -1: ([DD)V +14 -1: Illegal size: +8 -1: ([DIID)V +7 -1: (II[I)I +17 -1: java_profile_name +28 -1: java/util/AbstractCollection +43 -1: (Ljava/net/URL;)[Ljava/security/CodeSource; +62 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/net/URLStreamHandler; +33 -1: [Ljava/util/HashMap$Node; +15 -1: (Native Method) +11 -1: fileNameMap +26 -1: ()Ljava/util/ListIterator; +25 -1: java/util/LinkedList$Node +18 -1: SELECT_ALTERNATIVE +35 -1: (Ljava/lang/Object;)Ljava/util/Set; +19 -1: java/io/IOException +16 -1: : already loaded +9 -1: image/gif +6 -1: (TE;)I +25 -1: (Ljava/util/Properties;)V +40 -1: (Ljava/lang/String;)Ljava/nio/file/Path; +19 -1: checkedNavigableMap +9 -1: checkInt( +17 -1: getContentTypeFor +26 -1: ()Ljava/io/FileDescriptor; +69 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/ref/ReferenceQueue;)V +6 -1: (TE;)V +25 -1: WARNING: Default charset +14 -1: ZipFile closed +2 -1: CA +6 -1: (TE;)Z +64 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesToLongTask +15 -1: FileSystem.java +75 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V +10 -1: FileLoader +44 -1: (Lsun/util/PreHashedMap;)[Ljava/lang/Object; +19 -1: availableProcessors +2 -1: CN +36 -1: ([JII)Ljava/util/Spliterator$OfLong; +11 -1: access$1100 +18 -1: getFieldAtIfLoaded +30 -1: PrivilegedActionException.java +6 -1: EUC-JP +20 -1: (F)Ljava/lang/Float; +22 -1: unable to instantiate +31 -1: java/lang/reflect/ReflectAccess +23 -1: (Ljava/lang/Object;JC)V +3 -1: get +59 -1: ([TT;IILjava/util/Comparator<-TT;>;)V +2 -1: DE +13 -1: GMT_ID_LENGTH +7 -1: execute +12 -1: MethodHandle +18 -1: AllPermission.java +54 -1: (Ljava/util/Locale;)Lsun/util/locale/LocaleExtensions; +23 -1: MapReduceKeysToLongTask +12 -1: varargsArray +23 -1: java/util/jar/JarFile$1 +23 -1: java/util/jar/JarFile$2 +23 -1: java/util/jar/JarFile$3 +12 -1: getAndUpdate +13 -1: reserveMemory +17 -1: expungeStaleEntry +6 -1: EUC-KR +120 -1: Ljava/lang/ref/WeakReference;Ljava/util/Map$Entry; +69 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;)Ljava/util/regex/Matcher; +26 -1: ()Ljava/util/NavigableMap; +7 -1: L_PCHAR +23 -1: (Ljava/lang/String$1;)V +4 -1: KEYS +37 -1: (Ljava/util/List;Ljava/lang/Object;)I +31 -1: Ljava/lang/ArithmeticException; +15 -1: [Ljava/net/URL; +37 -1: (Ljava/util/List;Ljava/lang/Object;)V +18 -1: MAX_HIGH_SURROGATE +6 -1: (JCZ)V +4 -1: mark +17 -1: setMethodAccessor +21 -1: java/io/ExpiringCache +21 -1: PrivilegedAction.java +21 -1: MappedByteBuffer.java +2 -1: FR +10 -1: copyMemory +8 -1: L_SERVER +13 -1: assertionLock +12 -1: searchValues +46 -1: (Ljava/util/Collection<*>;Ljava/lang/Object;)I +21 -1: ProtectionDomainCache +32 -1: USE_PREDEFINED_INTERPRET_METHODS +2 -1: GB +16 -1: getFinalRefCount +23 -1: Ljava/lang/ClassLoader; +4 -1: mask +94 -1: (Ljava/util/function/ToDoubleFunction<-TT;>;)Ljava/util/Comparator; +4 -1: bind +41 -1: (Ljava/lang/Class<*>;I)Ljava/lang/Object; +9 -1: COUNT_GWT +16 -1: DASH_PUNCTUATION +24 -1: UNICODE_LOCALE_EXTENSION +15 -1: checkInvariants +10 -1: stringSize +12 -1: deepHashCode +30 -1: java/security/cert/Certificate +19 -1: America/Los_Angeles +19 -1: unmappableForLength +6 -1: UTF-16 +10 -1: methodType +21 -1: sun/misc/URLClassPath +19 -1: META-INF/INDEX.LIST +10 -1: jniVersion +6 -1: IBM437 +29 -1: sun/reflect/FieldAccessorImpl +21 -1: ()Ljava/lang/Package; +32 -1: java/security/SecurityPermission +57 -1: (Lsun/util/calendar/Era;)Lsun/util/calendar/CalendarDate; +34 -1: [Ljava/util/concurrent/locks/Lock; +11 -1: replacement +20 -1: ()Ljava/lang/String; +6 -1: resize +12 -1: UTF_32BE_BOM +26 -1: (Ljava/util/jar/JarFile;)V +24 -1: DEFAULT_INITIAL_CAPACITY +87 -1: (ILjava/lang/Object;Ljava/lang/Class;)Ljava/util/concurrent/ConcurrentHashMap$TreeNode; +74 -1: (Ljava/util/jar/JarFile;)Ljava/util/Enumeration; +18 -1: parameterSlotDepth +26 -1: (Ljava/util/jar/JarFile;)Z +18 -1: makePlatformString +24 -1: doPrivilegedWithCombiner +48 -1: (Ljava/lang/String;)Lsun/util/calendar/ZoneInfo; +27 -1: ()Ljava/lang/ref/Reference; +40 -1: java/util/ArrayList$ArrayListSpliterator +67 -1: ([Ljava/lang/Object;IILjava/util/Comparator;[Ljava/lang/Object;II)V +2 -1: ID +19 -1: stringPropertyNames +28 -1: (Ljava/util/Collections$1;)V +12 -1: STATE_YELLOW +12 -1: isNormalized +10 -1: fromIndex( +16 -1: getFloatVolatile +37 -1: Lsun/util/calendar/BaseCalendar$Date; +10 -1: properties +17 -1: peakFinalRefCount +102 -1: (Ljava/util/HashMap$Node;Ljava/util/HashMap$Node;)Ljava/util/HashMap$TreeNode; +68 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle; +2 -1: IT +9 -1: ([BI[BI)V +51 -1: scl permissions SecureClassLoader assigns +36 -1: (Ljava/util/Set;Ljava/lang/Object;)V +11 -1: ([SII[SII)V +21 -1: sun.io.useCanonCaches +18 -1: Illegal capacity: +22 -1: (Ljava/lang/Integer;)I +83 -1: ([Ljava/lang/Object;Ljava/lang/StringBuilder;Ljava/util/Set<[Ljava/lang/Object;>;)V +65 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;II)V +17 -1: java/util/Objects +48 -1: (ILjava/util/List;)Ljava/lang/invoke/LambdaForm; +31 -1: java/util/Properties$XmlSupport +10 -1: L_LOWALPHA +13 -1: long overflow +25 -1: NullPointerException.java +32 -1: (I)Ljava/lang/StackTraceElement; +34 -1: ()[Ljava/lang/reflect/Constructor; +2 -1: JP +3 -1: SST +12 -1: ShortCountry +48 -1: (Ljava/util/stream/Collector;)Ljava/lang/Object; +29 -1: Lsun/reflect/CallerSensitive; +10 -1: addElement +12 -1: lastReturned +6 -1: putInt +34 -1: sun.misc.JarIndex.metaInfFilenames +13 -1: getBaseLocale +20 -1: StringTokenizer.java +8 -1: entrySet +11 -1: getTypeName +17 -1: America/Sao_Paulo +5 -1: \t... +35 -1: (Lsun/util/calendar/CalendarDate;)I +28 -1: java/lang/StackOverflowError +35 -1: (Lsun/util/calendar/CalendarDate;)J +10 -1: logicalAnd +18 -1: csISOLatinCyrillic +43 -1: (Ljava/lang/String;II)Ljava/nio/CharBuffer; +73 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;Z)Ljava/lang/invoke/MethodType; +14 -1: aliases_MS1250 +14 -1: aliases_MS1251 +17 -1: getImplMethodKind +17 -1: getLastAccessTime +14 -1: aliases_MS1252 +14 -1: aliases_MS1253 +35 -1: (Lsun/util/calendar/CalendarDate;)V +2 -1: KR +14 -1: aliases_MS1254 +14 -1: getGenericInfo +8 -1: utf_32be +14 -1: aliases_MS1257 +35 -1: (Lsun/util/calendar/CalendarDate;)Z +13 -1: StringEncoder +7 -1: LDT2037 +7 -1: generic +2 -1: L9 +45 -1: ([DLjava/util/function/IntToDoubleFunction;)V +17 -1: isOtherAlphabetic +9 -1: implWrite +24 -1: PC-Multilingual-850+euro +12 -1: valueMatches +78 -1: (Ljava/lang/String;Lsun/util/locale/ParseStatus;)Lsun/util/locale/LanguageTag; +3 -1: gmt +19 -1: (Ljava/io/Reader;)V +25 -1: (JJ)Ljava/nio/ByteBuffer; +7 -1: val$url +26 -1: (Ljava/nio/ByteBuffer;IJ)V +10 -1: isImplicit +19 -1: getDeclaredClasses0 +4 -1: (I)B +4 -1: (I)C +4 -1: (I)D +9 -1: byteValue +4 -1: (I)F +5 -1: ([J)I +6 -1: isLive +5 -1: sleep +4 -1: (I)I +4 -1: (I)J +6 -1: outBuf +77 -1: Ljava/util/AbstractCollection;Ljava/util/Set; +4 -1: (I)S +5 -1: ([J)V +4 -1: (I)V +30 -1: (I[C)Ljava/lang/StringBuilder; +14 -1: intBitsToFloat +4 -1: (I)Z +15 -1: MethodType.java +14 -1: resolveSibling +9 -1: Enum.java +111 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;[Ljava/util/concurrent/ConcurrentHashMap$Node;)V +14 -1: IS_CONSTRUCTOR +4 -1: bits +34 -1: java/security/PermissionCollection +9 -1: autoFlush +21 -1: java/util/Collections +12 -1: bindReceiver +20 -1: DMH.invokeStaticInit +11 -1: charsetName +14 -1: x-utf-32be-bom +5 -1: cause +7 -1: handle0 +43 -1: ([I[C[Ljava/lang/invoke/LambdaForm$Name;I)Z +30 -1: getDefaultAllowUserInteraction +18 -1: ConcurrentMap.java +35 -1: (Ljava/lang/String;Z)Ljava/net/URL; +33 -1: Ljava/nio/charset/CharsetDecoder; +36 -1: java/lang/invoke/MethodHandleStatics +34 -1: java/util/concurrent/ConcurrentMap +16 -1: collectArguments +22 -1: packageAssertionStatus +79 -1: (JLjava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)J +39 -1: Cannot reflectively create enum objects +62 -1: attempt to add a Permission to a readonly PermissionCollection +22 -1: FieldAccessorImpl.java +9 -1: ByteCache +4 -1: TRUE +85 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Comparable; +17 -1: java.library.path +7 -1: encoder +21 -1: default locale = +11 -1: secondOfDay +37 -1: (Lsun/util/calendar/ZoneInfoFile$1;)V +35 -1: sun/reflect/UnsafeFieldAccessorImpl +24 -1: (Ljava/lang/Object;JJJ)V +16 -1: countStackFrames +24 -1: (Ljava/lang/Object;JJJ)Z +17 -1: nonfairTryAcquire +20 -1: ArrayListSpliterator +5 -1: /DMH= +68 -1: (Ljava/lang/CharSequence;Ljava/lang/CharSequence;)Ljava/lang/String; +2 -1: PI +8 -1: cspcp852 +112 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/util/Locale; +8 -1: cspcp855 +58 -1: (Ljava/lang/Object;JLjava/lang/Object;Ljava/lang/Object;)Z +33 -1: sun/misc/PerfCounter$CoreCounters +6 -1: CESU_8 +7 -1: vmslots +4 -1: Init +7 -1: handler +11 -1: getProperty +10 -1: isVolatile +8 -1: ([J[IJ)I +25 -1: ()Ljava/lang/ClassLoader; +8 -1: asChange +81 -1: (Ljava/net/URLClassLoader;Ljava/lang/String;Lsun/misc/Resource;)Ljava/lang/Class; +12 -1: naturalOrder +8 -1: getState +40 -1: (Ljava/lang/Object;I)[Ljava/lang/String; +36 -1: java/security/AccessControlException +10 -1: linkBefore +48 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;Z)V +26 -1: (Ljava/util/WeakHashMap;)V +23 -1: bad method type alias: +7 -1: putChar +18 -1: basicTypeSignature +33 -1: sun/misc/InvalidJarIndexException +13 -1: getPrivateuse +14 -1: isConstantZero +24 -1: java/io/FilePermission$1 +9 -1: Long.java +19 -1: getLocaleExtensions +10 -1: discovered +17 -1: Invalid file path +12 -1: MAX_MH_ARITY +20 -1: observesDaylightTime +31 -1: Ljava/lang/invoke/MethodHandle; +6 -1: , end +24 -1: java/io/FileDescriptor$1 +12 -1: loadLibrary. +11 -1: Method.java +12 -1: loadLibrary0 +23 -1: java/util/stream/Stream +37 -1: sun.lang.ClassLoader.allowArraySyntax +8 -1: appClass +15 -1: FileReader.java +5 -1: (IF)I +29 -1: [Ljava/lang/ClassValue$Entry; +12 -1: (principals +30 -1: jar jar verification +22 -1: ARRAY_CHAR_BASE_OFFSET +18 -1: newDirectoryStream +4 -1: atan +5 -1: (IF)V +24 -1: (Ljava/lang/Character;)I +2 -1: TH +10 -1: startsWith +9 -1: baseCount +13 -1: canonicalize0 +47 -1: (Ljava/lang/ClassLoader;[Ljava/lang/Class<*>;)V +22 -1: Ljava/io/OutputStream; +2 -1: TW +10 -1: H_RESERVED +19 -1: URLClassLoader.java +16 -1: isAccessibleFrom +59 -1: Ljava/util/Hashtable; +33 -1: java/lang/invoke/ConstantCallSite +14 -1: Ljava/net/URL; +12 -1: deleteOnExit +20 -1: MAX_SKIP_BUFFER_SIZE +30 -1: [Ljava/lang/ref/WeakReference; +15 -1: contentPathProp +9 -1: initCause +53 -1: (Ljava/util/Queue;Ljava/lang/Class;)Ljava/util/Queue; +20 -1: java/util/TimeZone$1 +2 -1: UK +86 -1: (BLjava/lang/Class;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle; +51 -1: (II[Ljava/lang/Class;)Ljava/lang/invoke/MethodType; +18 -1: Lsun/misc/Cleaner; +31 -1: RuntimeInvisibleTypeAnnotations +2 -1: US +7 -1: makeInt +40 -1: sun/reflect/annotation/AnnotationSupport +28 -1: sun/reflect/misc/ReflectUtil +8 -1: utf_32le +40 -1: (Ljava/lang/Object;JLjava/lang/Object;)V +24 -1: java/nio/file/WatchEvent +66 -1: (Ljava/lang/Class;Ljava/lang/Object;)Ljava/lang/invoke/MethodType; +91 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class; +114 -1: (Ljava/lang/ThreadLocal;ILjava/lang/ThreadLocal$ThreadLocalMap$Entry;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry; +20 -1: internalWriteEntries +79 -1: (TT;Ljava/util/function/Supplier;)TT; +14 -1: bitIndex < 0: +88 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;)Ljava/lang/Object; +6 -1: , len +28 -1: java/io/BufferedOutputStream +11 -1: System.java +11 -1: csISOLatin1 +11 -1: csISOLatin2 +28 -1: Ljava/io/OutputStreamWriter; +27 -1: IllegalAccessException.java +11 -1: csISOLatin4 +14 -1: isDaylightTime +11 -1: csISOLatin5 +21 -1: getYearLengthInMonths +13 -1: canonicalizes +93 -1: "'s signer information does not match signer information of other classes in the same package +32 -1: ()Lsun/management/GcInfoBuilder; +37 -1: (IILjava/nio/charset/CoderResult$1;)V +10 -1: stateNames +46 -1: (Ljava/lang/String;)Ljava/nio/charset/Charset; +21 -1: acquireMethodAccessor +2 -1: X- +32 -1: java/security/ProtectionDomain$1 +5 -1: atan2 +32 -1: java/security/ProtectionDomain$2 +32 -1: java/security/ProtectionDomain$3 +41 -1: malformed input: partial character at end +18 -1: dropParameterTypes +44 -1: (Ljava/lang/String;)Ljava/lang/StringBuffer; +18 -1: CalendarUtils.java +5 -1: month +84 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction; +33 -1: sun/misc/JavaNioAccess$BufferPool +18 -1: SearchMappingsTask +38 -1: DelegatingConstructorAccessorImpl.java +80 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class<*>;)Ljava/lang/invoke/MemberName; +8 -1: instance +54 -1: Parameter annotations don't match number of parameters +14 -1: createConstant +35 -1: java/lang/invoke/MemberName$Factory +4 -1: scrt +34 -1: Ljava/lang/InstantiationException; +20 -1: allowUserInteraction +15 -1: java/util/Deque +16 -1: forEachRemaining +35 -1: (J)Lsun/util/calendar/CalendarDate; +13 -1: no such field +25 -1: java/nio/file/FileSystems +16 -1: expectedModCount +44 -1: (Ljava/io/File;ILjava/nio/charset/Charset;)V +12 -1: createString +15 -1: useDaylightTime +31 -1: java/util/Properties$LineReader +111 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/String;ILjava/lang/Class<*>;I[Ljava/lang/invoke/MemberName;)I +16 -1: java/util/Locale +26 -1: URLClassPath.getResource(" +58 -1: (Ljava/util/SortedMap;Ljava/lang/Class;Ljava/lang/Class;)V +10 -1: appendTail +7 -1: cleaner +78 -1: (Lsun/nio/cs/FastCharsetProvider;Ljava/lang/String;)Ljava/nio/charset/Charset; +18 -1: convertOldISOCodes +4 -1: year +38 -1: java/lang/ReflectiveOperationException +28 -1: (Ljava/lang/StringBuffer;B)V +27 -1: (D)Ljava/lang/StringBuffer; +17 -1: emptyNavigableSet +7 -1: indices +10 -1: is sealed +21 -1: SPECIFICATION_VERSION +3 -1: TE; +8 -1: addMonth +24 -1: java/util/HashMap$Values +17 -1: SEARCH_ALL_SUPERS +18 -1: uncaught exception +14 -1: declaredFields +2 -1: [B +2 -1: [C +8 -1: ABSTRACT +2 -1: [D +2 -1: [F +2 -1: [I +2 -1: [J +5 -1: false +36 -1: (Ljava/net/URL;Ljava/lang/String;J)V +12 -1: equalContext +11 -1: VOID_RESULT +2 -1: [S +24 -1: (JLjava/lang/Object;JJ)V +36 -1: Ljava/security/PermissionCollection; +2 -1: [Z +17 -1: floatToRawIntBits +2 -1: [] +21 -1: ()[Ljava/lang/Thread; +20 -1: [Ljava/lang/Integer; +42 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Z)V +19 -1: checkPrintJobAccess +40 -1: (Ljava/lang/Object;)Ljava/lang/Class<*>; +31 -1: (Lsun/reflect/FieldAccessor;Z)V +10 -1: reallyPoll +52 -1: (Ljava/lang/ref/Reference;)Ljava/lang/ref/Reference; +100 -1: (JLjava/util/function/Function<-TV;+TU;>;Ljava/util/function/Consumer<-TU;>;)V +19 -1: CheckedNavigableMap +48 -1: (Ljava/lang/String;)Ljava/lang/RuntimeException; +35 -1: java/util/Hashtable$ValueCollection +89 -1: (JLjava/util/function/ToDoubleFunction<-TK;>;DLjava/util/function/DoubleBinaryOperator;)D +10 -1: Stack.java +57 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Object;I)V +12 -1: getTimeOfDay +12 -1: reduceValues +22 -1: warnUnsupportedCharset +34 -1: (Ljava/lang/ref/Reference<+TS;>;)Z +31 -1: EEE, dd MMM yyyy HH:mm:ss 'GMT' +19 -1: setCachedLambdaForm +21 -1: (I)Ljava/lang/Object; +85 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;Ljava/util/Locale$1;)V +36 -1: java/security/AccessControlContext$1 +27 -1: Lsun/net/www/MessageHeader; +23 -1: ()[Ljava/lang/Class<*>; +14 -1: refKindIsValid +41 -1: sun/reflect/NativeConstructorAccessorImpl +6 -1: binary +23 -1: ()Ljava/nio/CharBuffer; +8 -1: getSpace +45 -1: bootstrap method failed to produce a CallSite +15 -1: getISO3Language +17 -1: TRANSITION_NSHIFT +163 -1: ([Ljava/lang/String;Ljava/util/Map;>;)Ljava/util/Map;>; +7 -1: os.name +38 -1: java/util/function/IntToDoubleFunction +8 -1: checkInt +21 -1: java/lang/VerifyError +42 -1: sunpkcs11 SunPKCS11 provider debugging +19 -1: URI is not absolute +23 -1: java/io/DataInputStream +53 -1: (Ljava/lang/Object;)Ljava/nio/charset/CharsetEncoder; +2 -1: _# +41 -1: (Ljava/io/FilenameFilter;)[Ljava/io/File; +26 -1: Ljava/util/jar/Attributes; +7 -1: collect +17 -1: Lsun/misc/Unsafe; +97 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodHandle; +78 -1: (Ljava/util/Enumeration;)Ljava/util/ArrayList; +28 -1: (II)Ljava/lang/StringBuffer; +54 -1: (Ljava/lang/reflect/Constructor<*>;)Ljava/lang/String; +28 -1: ()Ljava/util/ResourceBundle; +48 -1: java/util/ArraysParallelSortHelpers$FJInt$Sorter +9 -1: no access +57 -1: Ljava/lang/ref/ReferenceQueue; +7 -1: getPerf +11 -1: getClassAt0 +11 -1: rtypeOffset +20 -1: thread can't be null +12 -1: addArguments +12 -1: utf_32le_bom +21 -1: allowThreadSuspension +25 -1: defaultExpectedLineLength +11 -1: removeFirst +13 -1: reduceEntries +20 -1: Read-ahead limit < 0 +57 -1: (Ljava/util/Collection<-TT;>;[TT;)Z +39 -1: ()Ljava/lang/invoke/MemberName$Factory; +13 -1: ZipCoder.java +16 -1: java/lang/Thread +27 -1: java/lang/NoSuchMethodError +66 -1: (Ljava/util/jar/JarFile;Ljava/net/URL;)[Ljava/security/CodeSource; +22 -1: java/lang/StringBuffer +3 -1: TK; +34 -1: (I)Ljava/lang/invoke/MethodHandle; +30 -1: (Ljava/lang/reflect/Method;Z)V +13 -1: file.encoding +14 -1: removeTreeNode +27 -1: sun/misc/JavaSecurityAccess +58 -1: ([Ljava/lang/Object;ILjava/lang/Class;)[Ljava/lang/Object; +19 -1: equalLimitedContext +22 -1: appendVmSynonymMessage +10 -1: applyAsInt +23 -1: privateGetPublicMethods +11 -1: dumpThreads +25 -1: RuntimeVisibleAnnotations +37 -1: (IF)Ljava/lang/AbstractStringBuilder; +18 -1: getBooleanVolatile +27 -1: (Ljava/util/zip/ZipFile;J)V +25 -1: INITIAL_QUOTE_PUNCTUATION +51 -1: (Ljava/util/Map;)[Ljava/lang/annotation/Annotation; +54 -1: (ILjava/lang/Object;)Ljava/lang/AbstractStringBuilder; +20 -1: reflectionDataOffset +2 1: aa +51 -1: (Ljava/util/jar/Attributes$Name;)Ljava/lang/String; +13 -1: transferLinks +18 -1: java/util/Vector$1 +10 -1: ensureOpen +22 -1: getDeclaredConstructor +2 -1: am +19 -1: NF_allocateInstance +66 -1: (Ljava/util/Spliterator$OfDouble;Z)Ljava/util/stream/DoubleStream; +6 -1: ([SS)I +17 -1: newReflectionData +19 -1: subclassAuditsQueue +11 -1: access$1200 +16 -1: ValueSpliterator +18 -1: preparedLambdaForm +38 -1: (Ljava/net/URL;)Ljava/net/InetAddress; +14 -1: getMaxPriority +32 -1: ()[Ljava/lang/StackTraceElement; +67 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesToDoubleTask +62 -1: (Ljava/util/Hashtable;)V +6 -1: EXTHDR +14 -1: java/util/Date +2 -1: az +6 -1: ([SS)V +15 -1: arrayBaseOffset +9 -1: isTrusted +23 -1: (Ljava/lang/Object;JD)V +2 -1: bb +10 -1: ([BII[BI)V +7 -1: toLower +14 -1: invoke_LLLLL_L +7 -1: jarfile +42 -1: (Ljava/lang/String;)Lsun/misc/PerfCounter; +28 -1: java/lang/ref/Reference$Lock +16 -1: java/util/BitSet +22 -1: jarfile parsing error! +18 -1: jdk_update_version +14 -1: invoke_LLLLL_V +20 -1: java/util/LinkedList +22 -1: erasedInvokerWithDrops +25 -1: timeout value is negative +21 -1: getCalendarProperties +25 -1: not a method descriptor: +2 -1: cb +31 -1: (Lsun/misc/JavaUtilJarAccess;)V +2 -1: cd +43 -1: Lsun/util/PreHashedMap; +12 -1: getEntrySize +2 -1: ce +24 -1: guessContentTypeFromName +2 -1: ch +14 -1: JulianCalendar +22 -1: [Ljava/lang/Cloneable; +122 -1: Ljava/util/AbstractCollection;Ljava/util/Deque;Ljava/lang/Cloneable;Ljava/io/Serializable; +34 -1: Lsun/util/locale/BaseLocale$Cache; +14 -1: LinkedEntrySet +72 -1: Ljava/util/AbstractSet;Ljava/io/Serializable; +39 -1: ()Ljava/io/ObjectOutputStream$PutField; +2 -1: cs +8 -1: indexFor +25 -1: (Ljava/util/List<+TE;>;)V +7 -1: subpath +11 -1: invokeExact +14 -1: setFileNameMap +22 -1: LangReflectAccess.java +8 -1: referent +34 -1: java/util/MissingResourceException +77 -1: (Ljava/lang/String;Ljava/util/jar/Manifest;Ljava/net/URL;)Ljava/lang/Package; +11 -1: ([FII[FII)V +17 -1: getParameterCount +18 -1: isMemberAccessible +10 -1: getExtDirs +69 -1: (Ljava/util/List<-TT;>;Ljava/util/List<+TT;>;)V +9 -1: getNextPC +13 -1: setProperties +2 -1: de +16 -1: generateCertPath +6 -1: decode +16 -1: getDefaultParent +50 -1: (Ljava/net/URL;[Ljava/security/cert/Certificate;)V +24 -1: Certificate factory for +35 -1: ()Ljava/lang/reflect/AnnotatedType; +2 -1: ee +12 -1: asLongBuffer +7 -1: PRIVATE +16 -1: aliases_UTF_32BE +2 -1: en +2 -1: eq +7 -1: indexOf +136 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class<+Ljava/lang/Throwable;>;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle; +24 -1: (Ljava/lang/Class<*>;I)V +72 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/IllegalAccessException; +35 -1: java/util/jar/JavaUtilJarAccessImpl +24 -1: (Ljava/lang/Class<*>;I)Z +2 -1: ex +24 -1: getProtectionDomainCache +101 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;Ljava/lang/String;JLjava/security/AccessControlContext;)V +3 -1: hit +8 -1: UTF_16BE +2 -1: fd +16 -1: EmptyEnumeration +4 -1: attr +16 -1: fromIndex < -1: +7 -1: getIntB +22 -1: java/io/FilePermission +2 -1: fr +2 -1: fs +7 -1: lazySet +7 -1: getIntL +37 -1: configfile JAAS ConfigFile loading +24 -1: sun/nio/cs/StreamEncoder +40 -1: (Ljava/time/ZoneId;)Ljava/util/TimeZone; +132 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/BiConsumer;)V +2 -1: gc +18 -1: Ljava/lang/Thread; +10 -1: cacheArray +48 -1: (Ljava/util/jar/JarFile;)Ljava/util/jar/JarFile; +61 -1: (Ljava/util/NavigableMap;Ljava/lang/Class;Ljava/lang/Class;)V +8 -1: readByte +7 -1: ([S[S)Z +24 -1: findBootstrapClassOrNull +2 -1: hb +7 -1: REPLACE +45 -1: ()Ljava/util/Enumeration; +10 -1: isOverflow +2 -1: he +13 -1: getCachedJan1 +12 -1: getClassPath +8 -1: leapYear +31 -1: java/lang/invoke/MethodTypeForm +10 -1: ANNOTATION +20 -1: getGregorianCalendar +11 -1: ISO_8859_13 +11 -1: ISO_8859_15 +6 -1: invoke +2 -1: ht +7 -1: ListItr +15 -1: synchronizedMap +7 -1: cleanup +94 -1: (Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;)Lsun/reflect/annotation/AnnotationType; +3 -1: TT; +69 -1: (JLsun/util/calendar/CalendarDate;)Lsun/util/calendar/Gregorian$Date; +81 -1: (Ljava/util/HashMap$TreeNode;)Z +20 -1: Min. Heap Size: +33 -1: (IZ)Ljava/lang/invoke/MethodType; +2 -1: id +7 -1: ([DI)[D +37 -1: (Ljava/lang/reflect/Constructor<*>;)I +42 -1: ;>([TT;II)V +13 -1: addSuppressed +28 -1: internalMemberNameEnsureInit +2 -1: in +17 -1: getCompressedSize +34 -1: sun/misc/Launcher$AppClassLoader$1 +88 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class<*>;)Ljava/security/AccessControlContext; +37 -1: (Ljava/lang/reflect/Constructor<*>;)V +2 -1: is +2 -1: it +6 -1: ENDOFF +4 -1: void +2 -1: iw +14 -1: emptySortedSet +2 -1: ix +17 -1: unicode-1-1-utf-8 +64 -1: (Ljava/lang/Class;Ljava/util/List;)Ljava/lang/invoke/MethodType; +46 -1: (Lsun/misc/URLClassPath$Loader;)Ljava/net/URL; +2 -1: ja +13 -1: synchronized +76 -1: ([DLjava/util/function/IntToDoubleFunction;)Ljava/util/function/IntConsumer; +11 -1: wrapperType +51 -1: ()Ljava/util/Comparator; +106 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/Object; +17 -1: removeAllElements +2 -1: ji +24 -1: java/util/Vector$ListItr +14 -1: getNestedTypes +6 -1: L_MARK +27 -1: Source does not fit in dest +2 -1: l1 +2 -1: jp +2 -1: l2 +4 -1: (J)B +57 -1: (Ljava/lang/String;Ljava/util/Locale;I)Ljava/lang/String; +4 -1: (J)C +27 -1: ForEachTransformedValueTask +2 -1: l4 +26 -1: java/util/Hashtable$KeySet +4 -1: (J)D +2 -1: l5 +39 -1: java/security/BasicPermissionCollection +4 -1: (J)F +2 -1: jv +29 -1: MapReduceMappingsToDoubleTask +18 -1: copyFromShortArray +2 -1: l9 +3 -1: TV; +4 -1: (J)I +4 -1: (J)J +23 -1: Lsun/util/calendar/Era; +8 -1: x-EUC-TW +15 -1: checkSetFactory +7 -1: Special +4 -1: (J)S +4 -1: (J)V +7 -1: invoke_ +25 -1: (IC)Ljava/nio/ByteBuffer; +68 -1: (JLjava/util/concurrent/TimeUnit;)Ljava/nio/file/attribute/FileTime; +36 -1: ()Ljava/net/URLStreamHandlerFactory; +4 -1: (J)Z +181 -1: (Ljava/lang/Class<*>;Ljava/lang/ref/SoftReference;>;Ljava/lang/ref/SoftReference;>;)Z +9 -1: getOffset +46 -1: (ILjava/lang/String;)Ljava/lang/StringBuilder; +7 -1: element +15 -1: createByteArray +17 -1: uncaughtException +2 -1: ko +29 -1: java/nio/file/DirectoryStream +15 -1: getISOCountries +246 -1: (BLjava/lang/invoke/MemberName;Ljava/lang/Class<*>;Ljava/lang/Class;)Ljava/lang/invoke/MemberName;^Ljava/lang/IllegalAccessException;^TNoSuchMemberException; +7 -1: invoker +17 -1: langReflectAccess +10 -1: bindSingle +23 -1: java/lang/reflect/Proxy +2 -1: lb +2 -1: lc +29 -1: CREATE_CLASSLOADER_PERMISSION +5 -1: isSet +18 -1: ([Ljava/io/File;)V +15 -1: urlNoFragString +21 -1: DirectByteBuffer.java +15 -1: java.class.path +15 -1: createDirectory +4 -1: GMT +37 -1: sun/reflect/annotation/ExceptionProxy +28 -1: (Ljava/util/Map<+TK;+TV;>;)V +17 -1: getContentHandler +26 -1: GenericDeclRepository.java +56 -1: (Ljava/lang/String;)Ljava/lang/IllegalArgumentException; +15 -1: getJavaIOAccess +39 -1: java/util/Collections$EmptyListIterator +34 -1: java/lang/ConditionalSpecialCasing +82 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/lang/management/GarbageCollectorMBean; +58 -1: (Ljava/util/function/ToIntFunction;)Ljava/util/Comparator; +21 -1: ()Lsun/misc/Launcher; +2 -1: lt +92 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;IIILjava/util/concurrent/ConcurrentHashMap;)V +8 -1: disjoint +62 -1: (Ljava/net/URL;Ljava/lang/String;Ljava/net/URLStreamHandler;)V +24 -1: ([Ljava/lang/Object;)TT; +4 -1: lmap +8 -1: SATURDAY +12 -1: toStringUTF8 +91 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/function/BinaryOperator;)Ljava/lang/Object; +46 -1: pkcs11 PKCS11 session manager debugging +27 -1: (Z)Ljava/lang/StringBuffer; +7 -1: forEach +17 -1: (Ljava/io/File;)I +17 -1: (Ljava/io/File;)J +5 -1: RESET +6 -1: isFile +14 -1: Exception.java +8 -1: isPublic +27 -1: computeInitialPreparedForms +50 -1: (BZLjava/lang/Class;)Ljava/lang/invoke/LambdaForm; +19 -1: getAvailableLocales +17 -1: (Ljava/io/File;)V +28 -1: ()Ljava/nio/charset/Charset; +10 -1: appendNull +17 -1: (Ljava/io/File;)Z +23 -1: java/lang/InternalError +2 -1: ne +6 -1: radix +8 -1: checksum +66 -1: (Lsun/net/www/MessageHeader;Ljava/lang/String;Ljava/lang/Object;)V +45 -1: (Ljava/io/FilenameFilter;)[Ljava/lang/String; +8 -1: checkJar +28 -1: default format locale = +13 -1: normalizeTime +26 -1: java/util/AbstractList$Itr +30 -1: java/util/function/IntFunction +7 -1: TIS-620 +12 -1: reverseBytes +2 -1: of +26 -1: java/lang/ClassFormatError +109 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle; +10 -1: delimiters +20 -1: indexOfSupplementary +16 -1: aliases_UTF_32LE +134 -1: (Ljava/util/Map;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/Map; +17 -1: [Ljava/lang/Long; +2 -1: or +12 -1: getClassName +31 -1: (Ljava/nio/charset/Charset;FF)V +6 -1: ([FF)I +39 -1: (Ljava/util/Locale;)[Ljava/lang/String; +33 -1: java/util/WeakHashMap$KeyIterator +8 -1: UTF_16LE +12 -1: isISOControl +75 -1: (Ljava/nio/CharBuffer;Ljava/nio/ByteBuffer;Z)Ljava/nio/charset/CoderResult; +7 -1: ([I[I)Z +28 -1: Self-causation not permitted +6 -1: ([FF)V +14 -1: defaultCharset +12 -1: isJavaLetter +2 -1: pm +39 -1: cannot reflectively invoke MethodHandle +20 -1: getSystemClassLoader +42 -1: ([Ljava/lang/Object;IILjava/lang/Object;)I +56 -1: (Ljava/lang/Object;Ljava/lang/String;)Ljava/lang/Object; +42 -1: ([Ljava/lang/Object;IILjava/lang/Object;)V +12 -1: ZipFile.java +43 -1: (Ljava/util/zip/ZipFile;)Ljava/lang/String; +22 -1: Ljava/net/InetAddress; +15 -1: getCharVolatile +32 -1: ()[Ljava/lang/reflect/Parameter; +13 -1: delimsChanged +13 -1: getFileSystem +13 -1: METHOD_RETURN +20 -1: sun/misc/PerfCounter +61 -1: (Ljava/util/HashMap;)Ljava/util/HashMap$Node; +8 -1: newIndex +18 -1: getDisplayLanguage +36 -1: (C)Ljava/lang/AbstractStringBuilder; +36 -1: java/lang/StringCoding$StringEncoder +12 -1: forEachEntry +23 -1: [Ljava/io/Serializable; +13 -1: totalCapacity +26 -1: java/io/FileOutputStream$1 +14 -1: signatureArity +90 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;[Ljava/security/cert/Certificate;)V +17 -1: reflectionFactory +6 -1: ibm737 +17 -1: fillInStackTrace0 +16 -1: allocateInstance +52 -1: (Lsun/util/locale/BaseLocale$Key;)Ljava/lang/String; +9 -1: addExtURL +16 -1: copyFromIntArray +65 -1: (Ljava/security/Permission;Z)Ljava/security/PermissionCollection; +57 -1: java/util/concurrent/ConcurrentHashMap$SearchMappingsTask +10 -1: toEpochDay +4 -1: gate +24 -1: sun/nio/cs/UTF_8$Decoder +8 -1: entries2 +18 -1: isCharsetSupported +10 -1: toCustomID +2 -1: rw +33 -1: java/nio/ByteBufferAsFloatBufferB +25 -1: (ID)Ljava/nio/ByteBuffer; +12 -1: addTimeOfDay +61 -1: (Ljava/security/ProtectionDomain;Ljava/security/Permission;)Z +2 -1: sd +25 -1: (Ljava/net/InetAddress;)V +33 -1: java/nio/ByteBufferAsFloatBufferL +2 -1: se +15 -1: hasQueuedThread +24 -1: assertMemberIsConsistent +37 -1: java/util/Collections$UnmodifiableMap +2 -1: sp +20 -1: setJavaUtilJarAccess +96 -1: (Ljava/lang/String;[BIILjava/lang/ClassLoader;Ljava/security/ProtectionDomain;)Ljava/lang/Class; +8 -1: language +76 -1: (Ljava/util/SortedSet;)Ljava/util/SortedSet; +11 -1: findLibrary +61 -1: (Ljava/lang/Class<*>;)Lsun/reflect/annotation/AnnotationType; +6 -1: ([BZ)V +24 -1: DEFAULT_BYTE_BUFFER_SIZE +25 -1: (Ljava/util/ArrayList;I)V +2 -1: th +47 -1: (Ljava/util/Collection;)Ljava/util/Enumeration; +49 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/net/URL; +7 -1: ([D[D)Z +2 -1: to +22 -1: java/util/Locale$Cache +8 -1: iterator +30 -1: (Ljava/lang/StringBuilder;IZ)V +17 -1: ()Ljava/util/Set; +2 -1: tr +27 -1: (Ljava/nio/ByteBuffer;ISZ)V +6 -1: method +13 -1: allPermission +9 -1: ruleArray +8 -1: UTC_TIME +10 -1: LF_COUNTER +26 -1: Lsun/nio/cs/StreamDecoder; +25 -1: ()Lsun/util/calendar/Era; +6 -1: LOCHDR +21 -1: sun/net/www/MimeTable +12 -1: Cannot cast +2 -1: us +2 -1: ut +52 -1: Ljava/lang/invoke/MethodHandle$PolymorphicSignature; +6 -1: encode +15 -1: CharBuffer.java +24 -1: (C)Ljava/nio/ByteBuffer; +56 -1: (Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;)V +18 -1: getEnclosingMethod +56 -1: (Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;)Z +6 -1: ibm775 +9 -1: (IIIIII)I +44 -1: ([JLjava/util/function/IntToLongFunction;I)V +9 -1: (IIIIII)J +64 -1: (Ljava/util/Locale$LocaleKey;)Lsun/util/locale/LocaleExtensions; +2 -1: x- +2 -1: vm +5 -1: clock +9 -1: (IIIIII)V +10 -1: XmlSupport +19 -1: sun/nio/cs/US_ASCII +10 -1: toRealPath +5 -1: cp367 +6 -1: ST_END +58 -1: [Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule; +12 -1: hasSameRules +108 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Lsun/util/locale/LocaleExtensions; +22 -1: java/lang/Class$Atomic +4 -1: sync +6 -1: listen +12 -1: firstElement +142 -1: (Ljava/lang/Class;Ljava/lang/String;[Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B[B)Ljava/lang/reflect/Method; +18 -1: internalProperties +28 -1: (Ljava/lang/StringBuffer;C)V +7 -1: factory +18 -1: ()Ljava/util/List; +50 -1: (Ljava/util/concurrent/CountedCompleter;[D[DIIII)V +44 -1: (Ljava/lang/Class;)Lsun/invoke/util/Wrapper; +83 -1: (JLjava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)D +12 -1: erasedType: +53 -1: (Ljava/util/AbstractList;Ljava/util/AbstractList$1;)V +20 -1: Cannot find package +27 -1: java/util/ArrayList$ListItr +10 -1: copyMethod +23 -1: java/lang/ThreadLocal$1 +16 -1: iso_646.irv:1983 +42 -1: (Ljava/lang/Thread;Ljava/lang/Throwable;)V +19 -1: DEFAULT_LOAD_FACTOR +40 -1: ([Ljava/lang/Object;)[Ljava/lang/Object; +10 -1: (JJJ[BII)I +12 -1: singletonMap +8 -1: RESERVED +9 -1: zipAccess +21 -1: SynchronizedSortedMap +4 -1: flag +15 -1: UnmodifiableSet +18 -1: WrappedPrintWriter +7 -1: resume0 +2 -1: yi +10 -1: erasedType +31 -1: CHECK_AWT_EVENTQUEUE_PERMISSION +8 -1: +59 -1: (Ljava/lang/String;)Ljava/security/cert/CertificateFactory; +40 -1: java/lang/management/MemoryManagerMXBean +33 -1: newGetIntIllegalArgumentException +16 -1: iso_646.irv:1991 +58 -1: (Ljava/lang/ClassValue$Entry;)Ljava/lang/ClassValue$Entry; +2 -1: zc +26 -1: (Ljava/util/AbstractMap;)V +6 -1: THROWS +11 -1: toCharArray +64 -1: (Ljava/lang/reflect/Constructor;)Ljava/lang/reflect/Constructor; +2 -1: zh +68 -1: Ljava/lang/ref/SoftReference;>; +25 -1: (Ljava/util/Collection;)V +20 -1: getJdkSpecialVersion +17 -1: getTypeParameters +32 -1: [Ljava/lang/ClassValue$Entry<*>; +25 -1: (Ljava/util/Collection;)Z +26 -1: Lsun/nio/ch/Interruptible; +5 -1: 0.0p0 +5 -1: CACHE +7 -1: namesOK +21 -1: Ljava/lang/Exception; +51 -1: (Ljava/net/URL;Lsun/net/www/protocol/jar/Handler;)V +19 -1: jdk_special_version +66 -1: (Ljava/util/List;)Ljava/util/List; +75 -1: (Ljava/util/Comparator;Ljava/util/function/Function;)Ljava/util/Comparator; +11 -1: Arrays.java +19 -1: (Ljava/lang/Byte;)I +17 -1: java/lang/Class$1 +17 -1: java/lang/Class$2 +17 -1: java/lang/Class$3 +47 -1: java/lang/invoke/MethodHandleImpl$WrappedMember +17 -1: java/lang/Class$4 +44 -1: (Ljava/lang/Throwable;)Ljava/lang/Throwable; +9 -1: charCount +24 -1: ()Ljava/net/FileNameMap; +44 -1: sun/util/locale/provider/TimeZoneNameUtility +17 -1: not an array type +2 -1: {} +24 -1: (Lsun/misc/Launcher$1;)V +12 -1: directMemory +10 -1: parameters +5 -1: java. +14 -1: allocateDirect +51 -1: (Ljava/lang/StringBuffer;)Ljava/lang/StringBuilder; +23 -1: java/nio/file/Watchable +37 -1: createDiagnosticFrameworkNotification +54 -1: (Ljava/lang/Class<*>;Z)Ljava/lang/invoke/MethodHandle; +35 -1: sun/nio/cs/StandardCharsets$Aliases +9 -1: retDelims +11 -1: MAX_ENTRIES +12 -1: CumulateTask +64 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedKeyTask +3 -1: iae +12 -1: AF_PUTSTATIC +21 -1: java/lang/Throwable$1 +45 -1: (Ljava/util/HashMap;)Ljava/util/HashMap$Node; +77 -1: (JLjava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)I +5 -1: after +29 -1: (Ljava/security/CodeSource;)Z +248 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesToDoubleTask;Ljava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)V +6 -1: H_URIC +7 -1: L_DIGIT +7 -1: toNanos +24 -1: (D)Ljava/nio/ByteBuffer; +25 -1: getDiagnosticCommandMBean +6 2: [LFoo; +14 -1: path.separator +16 -1: toUnsignedString +40 -1: DIRECTIONALITY_EUROPEAN_NUMBER_SEPARATOR +87 -1: (Ljava/security/Permission;[Ljava/security/cert/Certificate;)Ljava/security/Permission; +16 -1: inheritedChannel +11 -1: audio/basic +27 -1: sun.classloader.findClasses +10 -1: queryCount +20 -1: NF_ensureInitialized +12 -1: getBufIfOpen +23 -1: sun/nio/cs/UTF_16LE_BOM +134 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;[Ljava/lang/Object;)Ljava/lang/invoke/CallSite; +17 -1: getImplMethodName +14 -1: linkMethod => +25 -1: Ljava/lang/invoke/Stable; +32 -1: Ljava/lang/annotation/Retention; +7 -1: doInput +9 -1: -_.!~*'() +62 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;B)V +18 -1: separateWithCommas +43 -1: com/sun/crypto/provider/CipherBlockChaining +14 -1: createTempFile +9 -1: implFlush +20 -1: getOffsetsByStandard +21 -1: OutOfMemoryError.java +7 -1: jce.jar +46 -1: java/util/Collections$UnmodifiableNavigableMap +30 -1: (Ljava/io/File;)Ljava/io/File; +15 -1: LinkedList.java +15 -1: iso_8859-9:1989 +50 -1: sun/reflect/generics/factory/CoreReflectionFactory +10 -1: : JVM has +19 -1: HeapByteBuffer.java +6 -1: getURL +37 -1: java/security/cert/CertificateFactory +23 -1: getAllowUserInteraction +12 -1: otherParents +25 -1: ARRAY_BOOLEAN_BASE_OFFSET +9 -1: L_UPALPHA +41 -1: ([Ljava/util/Hashtable$Entry<**>;TK;TV;)V +6 -1: LOCHOW +11 -1: access$1300 +30 -1: sun/reflect/MethodAccessorImpl +130 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/util/List; +9 -1: MALFORMED +38 -1: (Ljava/lang/String;I)Ljava/lang/Short; +26 -1: File format not recognised +12 -1: setTimeOfDay +19 -1: java/lang/Exception +15 -1: getOutputStream +74 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object; +41 -1: (Ljava/lang/String;Z)Ljava/util/TimeZone; +49 -1: Lsun/reflect/generics/repository/ClassRepository; +8 -1: getCerts +90 -1: (Ljava/lang/Class<*>;ZLjava/lang/Class<*>;)Ljava/util/List; +5 -1: clone +32 -1: ()Ljava/lang/ref/Reference$Lock; +15 -1: caseIgnoreMatch +23 -1: (Ljava/util/Set;)V +25 -1: enumerateStringProperties +9 -1: inherited +4 -1: flip +8 -1: setMonth +38 -1: (Ljava/util/function/Consumer<-TV;>;)V +55 -1: java/util/concurrent/ConcurrentHashMap$ReduceValuesTask +37 -1: getJavaSecurityProtectionDomainAccess +67 -1: (Ljava/util/NavigableSet;Ljava/lang/Class;)Ljava/util/NavigableSet; +10 -1: reduceKeys +14 -1: MAX_CODE_POINT +24 -1: getGenericExceptionTypes +8 -1: fraction +30 -1: java/lang/InterruptedException +46 -1: (Ljava/lang/String;II[BI)Ljava/nio/ByteBuffer; +114 -1: ([Ljava/util/HashMap$Node;Ljava/util/HashMap$TreeNode;)V +66 -1: (Ljava/lang/String;Ljava/lang/Throwable;)Ljava/lang/InternalError; +45 -1: (Ljava/lang/Object;)Ljava/lang/StringBuilder; +8 -1: putLongB +101 -1: (Ljava/nio/channels/ReadableByteChannel;Ljava/nio/charset/CharsetDecoder;I)Lsun/nio/cs/StreamDecoder; +16 -1: standardProvider +14 -1: parameterCount +59 -1: (Ljava/lang/String;Ljava/lang/ClassLoader;)Ljava/util/List; +8 -1: putLongL +12 -1: (TT;TV;TV;)Z +37 -1: Lsun/reflect/ConstructorAccessorImpl; +11 -1: ([CII[CII)V +14 -1: parameterArray +15 -1: | interpretName +62 -1: (JLjava/util/function/Function;Ljava/util/function/Consumer;)V +30 -1: (Z)Lsun/reflect/FieldAccessor; +19 -1: jvm_special_version +22 -1: java/util/ArrayDeque$1 +12 -1: initVersions +22 -1: java/lang/CharSequence +21 -1: NF_internalMemberName +5 -1: ()TE; +97 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;IZ)Ljava/lang/invoke/MethodHandle; +25 -1: java/nio/MappedByteBuffer +6 -1: addURL +17 -1: isConvertibleFrom +14 -1: extendWithType +9 -1: interrupt +11 -1: floorDivide +16 -1: x-ISO-2022-CN-GB +12 -1: CheckedQueue +7 -1: setLong +64 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;Ljava/lang/String;)V +108 -1: (Ljava/util/NavigableMap;)Ljava/util/NavigableMap; +38 -1: java/nio/channels/spi/SelectorProvider +17 -1: makeGuardWithTest +20 -1: (Ljava/util/List;Z)V +8 -1: val$path +12 -1: Runtime.java +7 -1: channel +71 -1: ([TT;IILjava/util/function/BinaryOperator;)V +18 -1: initializedHeaders +32 -1: ()[Lsun/launcher/LauncherHelper; +13 -1: jvInitialized +10 -1: getSeconds +7 -1: Decoder +20 -1: getYearFromFixedDate +6 -1: PREFIX +21 -1: sun.boot.library.path +11 -1: FIXED_DATES +33 -1: (JLjava/util/function/Consumer;)V +27 -1: initializeJavaAssertionMaps +13 -1: toOctalString +9 -1: fixResult +10 -1: typeParams +94 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;I)Ljava/util/concurrent/ConcurrentHashMap$Node; +4 -1: Help +11 -1: setIfNotSet +39 -1: java/lang/UnsupportedOperationException +15 -1: zip file closed +8 -1: floorDiv +10 -1: canExecute +10 -1: encodeLoop +18 -1: addRequestProperty +56 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/Object;I)V +10 -1: superclass +5 -1: close +56 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/Object;I)Z +6 -1: ignore +32 -1: ()Ljava/lang/ref/ReferenceQueue; +19 -1: java/util/Formatter +27 -1: java/lang/ClassLoaderHelper +23 -1: (Ljava/lang/Object;JZ)V +29 -1: java/nio/file/WatchEvent$Kind +6 -1: CENLEN +4 -1: SIZE +68 -1: (Ljava/util/Deque;)Ljava/util/Queue; +9 -1: isEscaped +12 -1: LF_INTERPRET +22 -1: (I)Ljava/lang/Integer; +60 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName; +49 -1: ([Ljava/lang/Class<*>;Ljava/lang/StringBuilder;)V +11 -1: getZipEntry +16 -1: metaInfFilenames +27 -1: (Ljava/lang/StringBuffer;)V +57 -1: (Ljava/lang/Object;)Ljava/util/WeakHashMap$Entry; +76 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;)Ljava/lang/Class<*>; +8 -1: ([CII)[B +27 -1: (Ljava/lang/StringBuffer;)Z +24 -1: getManifestFromReference +8 -1: ([CII)[C +10 -1: H_LOWALPHA +18 -1: FileURLMapper.java +12 -1: fxLaunchMode +24 -1: isMethodHandleInvokeName +17 -1: winTimeToFileTime +19 -1: checkTopLevelWindow +26 -1: MapReduceMappingsToIntTask +13 -1: NORM_PRIORITY +18 -1: lookupViaProviders +30 -1: (I)Ljava/util/LinkedList$Node; +3 -1: UTC +10 -1: UNMAPPABLE +68 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/invoke/MethodType;B)V +9 -1: META-INF/ +13 -1: Iterable.java +71 -1: ([Ljava/lang/reflect/Field;Ljava/lang/String;)Ljava/lang/reflect/Field; +9 -1: setOffset +8 -1: FJObject +50 -1: (Ljava/lang/CharSequence;)Ljava/util/StringJoiner; +23 -1: java/nio/HeapByteBuffer +23 -1: sun/util/PreHashedMap$1 +23 -1: sun/util/PreHashedMap$2 +34 -1: newGetCharIllegalArgumentException +40 -1: jca JCA engine class debugging +39 -1: (Ljava/lang/Object;I)Ljava/lang/Object; +42 -1: (Ljava/lang/String;)Ljava/net/InetAddress; +25 -1: (Ljava/net/FileNameMap;)V +44 -1: (Ljava/util/SortedMap;)Ljava/util/SortedMap; +52 -1: (Ljava/lang/String;Ljava/lang/Long;)Ljava/lang/Long; +27 -1: ()[Ljava/util/HashMap$Node; +29 -1: java/util/EmptyStackException +16 -1: not a field type +14 -1: Ljava/io/File; +28 -1: ()[Ljava/security/Principal; +69 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)V +5 -1: ()TK; +10 -1: ISO8859-13 +40 -1: java/lang/invoke/DirectMethodHandle$Lazy +30 -1: The object is not initialized. +10 -1: ISO8859-15 +88 -1: (Ljava/util/List;Ljava/lang/Class;)Ljava/util/List; +25 -1: (ZILjava/lang/String;II)Z +9 -1: stackSize +61 -1: (Ljava/util/Comparator;Ljava/lang/Object;Ljava/lang/Object;)I +16 -1: synchronizedList +90 -1: (Ljava/util/Comparator;Ljava/util/function/Function;Ljava/lang/Object;Ljava/lang/Object;)I +9 -1: nullCheck +174 -1: Ljava/util/concurrent/ConcurrentMap;Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet$WeakEntry;>; +14 -1: java/lang/Enum +3 -1: int +13 -1: detailMessage +56 -1: java/util/concurrent/ConcurrentHashMap$SearchEntriesTask +10 -1: ISO-8859-1 +10 -1: ISO-8859-2 +10 -1: ISO-8859-3 +10 -1: ISO-8859-4 +10 -1: ISO-8859-5 +10 -1: ISO-8859-6 +24 -1: ([Ljava/lang/Object;II)V +10 -1: ISO-8859-7 +10 -1: ISO-8859-8 +139 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$Node;)[Ljava/util/concurrent/ConcurrentHashMap$Node; +10 -1: ISO-8859-9 +5 -1: round +25 -1: DIRECTIONALITY_WHITESPACE +13 -1: NamedFunction +10 -1: startAgent +3 -1: ioe +7 -1: closing +24 -1: appendSchemeSpecificPart +56 -1: sun/reflect/ReflectionFactory$GetReflectionFactoryAction +83 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction; +17 -1: isCharsetDetected +11 -1: getJarFiles +22 -1: getEnclosingMethodInfo +11 -1: setReadable +61 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;)V +10 -1: attachment +34 -1: (Ljava/io/File;)Ljava/lang/String; +18 -1: ZipFileInputStream +15 -1: CodeSource.java +61 -1: (Ljava/util/jar/JarFile;)Ljava/util/List; +7 -1: cp00858 +108 -1: ([Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/invoke/LambdaForm$Name;II)Ljava/lang/invoke/LambdaForm$Name; +38 -1: ([DII)Ljava/util/Spliterator$OfDouble; +8 -1: val$name +11 -1: LF_REINVOKE +12 -1: validateTime +17 -1: copyFromCharArray +32 -1: throwSetIllegalArgumentException +14 -1: fieldModifiers +52 -1: (Ljava/lang/ClassValue;)Ljava/lang/ClassValue$Entry; +58 -1: (Ljava/io/OutputStream;Ljava/nio/charset/CharsetEncoder;)V +14 -1: generalInvoker +11 -1: interrupted +246 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsToLongTask;Ljava/util/function/ToLongBiFunction;JLjava/util/function/LongBinaryOperator;)V +20 -1: java/util/Dictionary +17 -1: getDoubleVolatile +41 -1: (Ljava/lang/Class<*>;Ljava/lang/Object;)Z +8 -1: intValue +24 -1: (F)Ljava/nio/ByteBuffer; +5 -1: reset +54 -1: (ILjava/util/List;)[Ljava/lang/invoke/LambdaForm$Name; +19 -1: [Ljava/util/Locale; +43 -1: (Ljava/lang/String;II)Ljava/nio/ByteBuffer; +38 -1: ()Ljava/io/ObjectInputStream$GetField; +18 -1: [Locked by thread +10 -1: checkedMap +16 -1: checkedSortedMap +14 -1: illegal symbol +16 -1: TITLECASE_LETTER +4 -1: root +22 -1: (ZLjava/lang/String;)V +27 -1: ([JII)Ljava/nio/LongBuffer; +15 -1: printStackTrace +30 -1: newConstructorForSerialization +14 -1: getPermissions +13 -1: toStringCache +15 -1: equalParamTypes +37 -1: throwFinalFieldIllegalAccessException +35 -1: (Ljava/lang/String;Ljava/io/File;)V +34 -1: java/nio/charset/CoderResult$Cache +3 -1: .\n\n +33 -1: Ljava/nio/charset/CharsetEncoder; +11 -1: lambdaForms +65 -1: (Ljava/lang/Class;)TT; +39 -1: (CLjava/lang/Class;Ljava/lang/Object;)Z +3 -1: ise +14 -1: forLanguageTag +45 -1: ([Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Z +36 -1: RuntimeInvisibleParameterAnnotations +12 -1: binarySearch +24 -1: getAssociatedAnnotations +10 -1: decoderFor +6 -1: ibm813 +10 -1: logicalXor +10 -1: setVarargs +71 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;Ljava/lang/Void;)V +4 -1: cast +6 -1: ibm819 +23 -1: getParentDelegationTime +8 -1: ([FII)[F +4 -1: .tmp +6 -1: (JII)J +27 -1: ()Ljava/lang/ref/Finalizer; +9 -1: sunec.jar +22 -1: java/net/URLConnection +41 -1: (Ljava/lang/Runnable;Ljava/lang/String;)V +20 -1: SecurityManager.java +18 -1: getZipFileOpenTime +7 -1: country +13 -1: inflaterCache +4 -1: +17 -1: java/lang/Runtime +125 -1: (Lsun/management/GcInfoBuilder;JJJ[Ljava/lang/management/MemoryUsage;[Ljava/lang/management/MemoryUsage;[Ljava/lang/Object;)V +24 -1: java/util/ResourceBundle +64 -1: Ljava/util/Hashtable; +79 -1: ([Ljava/util/WeakHashMap$Entry;[Ljava/util/WeakHashMap$Entry;)V +8 -1: x-ibm737 +39 -1: (Ljava/security/AccessControlContext;)Z +21 -1: (Ljava/lang/Class;I)V +4 -1: - +15 -1: calculateFields +22 -1: Ljava/util/Properties; +8 -1: getArray +21 -1: (Ljava/lang/Class;I)Z +41 -1: (Ljava/lang/ThreadGroup;)Ljava/lang/Void; +17 -1: Ljava/io/Console; +115 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/lang/Object; +12 -1: nextThreadID +81 -1: (Ljava/net/URLClassLoader;Ljava/lang/SecurityManager;Ljava/security/Permission;)V +23 -1: ARRAY_SHORT_BASE_OFFSET +10 -1: interpret_ +144 -1: (Ljava/net/URL;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V +20 -1: isIPv6LiteralAddress +13 -1: launcher_name +36 -1: java/util/function/IntToLongFunction +38 -1: java/util/WeakHashMap$EntrySpliterator +8 -1: copyInto +3 -1: ACT +11 -1: metafactory +31 -1: ([BLjava/nio/charset/Charset;)V +30 -1: java/lang/annotation/Retention +13 -1: getYearLength +42 -1: java/util/AbstractMap$SimpleImmutableEntry +31 -1: ()Ljava/lang/invoke/MemberName; +21 -1: sun/misc/JavaIOAccess +16 -1: jdk_build_number +8 -1: ST_RESET +96 -1: (BLjava/lang/Class;Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName; +13 -1: getTypeString +15 -1: maxCharsPerByte +8 -1: checkKey +49 -1: (Ljava/nio/charset/Charset;Lsun/nio/cs/UTF_8$1;)V +80 -1: (Ljava/lang/ClassValue;Ljava/lang/ClassValue$Entry;)Ljava/lang/ClassValue$Entry; +32 -1: Ljava/security/ProtectionDomain; +5 -1: ()TT; +6 -1: insert +10 -1: intersects +38 -1: ([Ljava/lang/Class;Ljava/lang/Class;)V +15 -1: java/lang/Class +12 -1: getPublicKey +37 -1: (ID)Ljava/lang/AbstractStringBuilder; +6 -1: ibm850 +6 -1: locsig +6 -1: ibm852 +19 -1: changeReferenceKind +3 -1: AET +42 -1: (Ljava/util/Collection;Ljava/lang/Class;)V +6 -1: ibm855 +16 -1: getPolicyNoCheck +39 -1: ([B)[[Ljava/lang/annotation/Annotation; +6 -1: ibm857 +10 -1: Error.java +38 -1: ()Ljava/util/List; +14 -1: createInstance +5 -1: cp437 +28 -1: Lsun/util/locale/BaseLocale; +17 -1: getStandardOffset +29 -1: sun/nio/cs/StandardCharsets$1 +36 -1: Ljava/security/ProtectionDomain$Key; +14 -1: ArrayList.java +78 -1: (Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName; +38 -1: java/lang/invoke/MethodHandleImpl$Lazy +42 -1: (Ljava/util/LinkedHashMap$Entry;)V +8 -1: getLongB +7 -1: vmentry +21 -1: lookupExtendedCharset +32 -1: ([TT;)[TT; +53 -1: Ljava/util/concurrent/ConcurrentHashMap$EntrySetView; +6 -1: ibm862 +8 -1: getLongL +32 -1: (Ljava/lang/invoke/MemberName;)J +67 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction; +6 -1: region +6 -1: ibm866 +89 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;I)Lsun/reflect/ConstructorAccessor; +22 -1: java/util/ListIterator +9 -1: wednesday +16 -1: unsuspendThreads +20 -1: Not a Proxy instance +45 -1: Ljava/lang/reflect/InvocationTargetException; +61 -1: (Ljava/lang/CharSequence;II)Ljava/lang/AbstractStringBuilder; +5 -1: ()TV; +32 -1: (Ljava/lang/invoke/MemberName;)V +82 -1: (Ljava/util/jar/JarFile;Ljava/util/jar/JarEntry;)[Ljava/security/cert/Certificate; +34 -1: java/lang/ClassValue$ClassValueMap +32 -1: (Ljava/lang/invoke/MemberName;)Z +15 -1: SPACE_SEPARATOR +17 -1: caseIgnoreCompare +58 -1: (Ljava/lang/Class;)Ljava/lang/invoke/MethodHandles$Lookup; +4 -1: Code +3 -1: AGT +54 -1: (Ljava/lang/StringBuilder;II)Ljava/lang/StringBuilder; +6 -1: ibm874 +15 -1: newMemberBuffer +42 -1: (Ljava/nio/file/Path;)Ljava/nio/file/Path; +33 -1: Ljava/lang/NumberFormatException; +10 -1: Field.java +67 -1: (JLjava/util/function/Function<-TK;+TU;>;)TU; +4 -1: rows +12 -1: MIN_PRIORITY +25 -1: URI has a query component +41 -1: provider security provider debugging +29 -1: sun/nio/cs/ISO_8859_1$Encoder +26 -1: (Ljava/util/zip/ZipFile;)I +26 -1: (Ljava/util/zip/ZipFile;)J +20 -1: Bad digit at end of +29 -1: Ljava/lang/RuntimePermission; +12 -1: initResolved +9 -1: loadFence +13 -1: fieldAccessor +26 -1: (Ljava/util/zip/ZipFile;)V +36 -1: java/lang/CloneNotSupportedException +19 -1: getBasicConstraints +16 -1: putOrderedObject +26 -1: (Ljava/util/zip/ZipFile;)Z +6 -1: target +50 -1: (Ljava/util/concurrent/CountedCompleter;[I[IIIII)V +16 -1: changeReturnType +13 -1: CAUSE_CAPTION +14 -1: checkExactType +50 -1: sun/util/locale/provider/LocaleServiceProviderPool +47 -1: java/lang/invoke/DirectMethodHandle$Constructor +20 -1: CallerSensitive.java +30 -1: java/security/ProtectionDomain +26 -1: java.launcher.opt.vmselect +4 -1: \tat +42 -1: java/util/ArraysParallelSortHelpers$FJLong +39 -1: (Ljava/lang/String;)[Ljava/lang/String; +19 -1: sun.net.www.content +34 -1: ([III)Ljava/util/stream/IntStream; +20 -1: (Ljava/util/Deque;)V +35 -1: (Ljava/lang/reflect/Constructor;)[B +16 -1: WeakHashMap.java +8 -1: ([III)[I +46 -1: (Ljava/util/Properties;Ljava/io/InputStream;)V +54 -1: (I)Ljava/util/concurrent/ConcurrentHashMap$KeySetView; +65 -1: (ILjava/lang/Object;Ljava/lang/Object;ZZ)Ljava/util/HashMap$Node; +27 -1: URI path component is empty +3 -1: -1- +32 -1: Ljava/io/InterruptedIOException; +9 -1: setLocale +7 -1: [^, ;]* +6 -1: format +61 -1: (Ljava/util/function/Supplier;IZ)Ljava/util/stream/IntStream; +20 -1: getRequestProperties +16 -1: reallocateMemory +28 -1: java/lang/IllegalAccessError +5 -1: query +83 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;II)Ljava/lang/invoke/MethodHandle; +7 -1: threadQ +6 -1: STATIC +7 -1: enqueue +21 -1: uninitializedCallSite +3 -1: -2- +26 -1: ()Ljava/util/NavigableSet; +27 -1: getUncaughtExceptionHandler +42 -1: ([Ljava/net/URL;)Ljava/net/URLClassLoader; +30 -1: java/lang/UnsatisfiedLinkError +39 -1: java/util/Collections$ReverseComparator +7 -1: resolve +4 -1: poll +7 -1: (TE;I)V +21 -1: : Unknown launch mode +53 -1: (Ljava/lang/Class;)[Ljava/lang/annotation/Annotation; +36 -1: sun.classloader.parentDelegationTime +25 -1: java/net/URLStreamHandler +39 -1: (Ljava/lang/Object;J)Ljava/lang/Object; +53 -1: Ljava/util/Map; +51 -1: java/util/ArraysParallelSortHelpers$FJDouble$Sorter +26 -1: getAnnotatedParameterTypes +18 -1: codePointCountImpl +7 -1: threads +12 -1: offsetBefore +29 -1: ()Ljava/util/Collection; +58 -1: (Lsun/invoke/util/Wrapper;)Ljava/lang/invoke/MethodHandle; +17 -1: DMH.invokeSpecial +3 -1: -3- +16 -1: decodeBufferLoop +43 -1: java/util/concurrent/atomic/AtomicReference +16 -1: reduceKeysToLong +27 -1: newIllegalArgumentException +3 -1: ALL +5 -1: cache +5 -1: queue +4 -1: 8bit +3 -1: -4- +35 -1: Ljava/util/Set; +9 -1: MIN_RADIX +26 -1: ZipFileInflaterInputStream +13 -1: MANIFEST_NAME +18 -1: java/util/TimeZone +175 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;Ljava/lang/invoke/MemberName;Ljava/lang/Class;Ljava/lang/invoke/DirectMethodHandle$1;)V +16 -1: getContentLength +11 -1: setDoOutput +22 -1: (Ljava/io/Closeable;)V +13 -1: TimeZone.java +28 -1: sun/misc/ExtensionDependency +6 -1: bindTo +3 -1: -5- +40 -1: ()[Ljava/util/WeakHashMap$Entry; +20 -1: ()Lsun/misc/Cleaner; +9 -1: compareTo +68 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsToDoubleTask +11 -1: checkedList +14 -1: (ITK;TV;ZZ)TV; +5 -1: greek +3 -1: jar +21 -1: (Ljava/lang/String;)B +21 -1: (Ljava/lang/String;)C +21 -1: (Ljava/lang/String;)D +5 -1: (JS)V +21 -1: (Ljava/lang/String;)F +13 -1: LETTER_NUMBER +14 -1: isAlphaNumeric +21 -1: (Ljava/lang/String;)I +73 -1: (Ljava/nio/charset/Charset;Ljava/lang/String;Ljava/lang/StringCoding$1;)V +21 -1: (Ljava/lang/String;)J +25 -1: makeExactOrGeneralInvoker +3 -1: -6- +25 -1: java/nio/StringCharBuffer +21 -1: Ljava/util/Hashtable; +8 -1: ENQUEUED +8 -1: finalize +22 -1: DirectLongBufferU.java +21 -1: (Ljava/lang/String;)S +10 -1: localhost: +33 -1: isKnownNotToHaveSpecialAttributes +21 -1: (Ljava/lang/String;)V +45 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;Z)V +21 -1: (Ljava/lang/String;)Z +22 -1: (Ljava/util/Vector;I)V +44 -1: java/nio/charset/UnsupportedCharsetException +23 -1: java/lang/CharacterName +7 -1: checkIO +33 -1: (I)Lsun/misc/URLClassPath$Loader; +90 -1: (Ljava/lang/Class<*>;Ljava/lang/reflect/Constructor<*>;)Ljava/lang/reflect/Constructor<*>; +18 -1: getHeaderFieldDate +9 -1: MIN_VALUE +95 -1: (Ljava/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject;)Ljava/util/Collection; +44 -1: (Ljava/lang/String;Z)Ljava/util/Enumeration; +8 -1: NOVEMBER +4 -1: gcal +17 -1: getConnectTimeout +124 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/Object; +24 -1: INDEXOFSUBLIST_THRESHOLD +16 -1: isJulianLeapYear +21 -1: reduceEntriesToDouble +15 -1: getPrefixLength +17 -1: is not param at +14 -1: inDaylightTime +39 -1: (Ljava/lang/Class;[I)Ljava/lang/Object; +5 -1: force +98 -1: (Ljava/lang/Class;Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z +40 -1: (Lsun/reflect/ConstructorAccessorImpl;)V +27 -1: RuntimeInvisibleAnnotations +17 -1: checkTargetChange +9 -1: skipBytes +4 -1: port +25 -1: sun/nio/cs/UTF_16$Encoder +28 -1: MIN_SUPPLEMENTARY_CODE_POINT +4 -1: node +11 -1: not param: +9 -1: debugInit +6 -1: setURL +14 -1: getMonthLength +23 -1: ()Ljava/nio/ByteBuffer; +17 -1: CALENDAR_JAPANESE +11 -1: access$1400 +16 -1: ()Ljava/net/URI; +29 -1: (IZ)Ljava/lang/StringBuilder; +15 -1: Native Library +30 -1: Invalid lambda deserialization +14 -1: throwException +18 -1: nothing to verify! +23 -1: (Ljava/lang/Object;JF)V +3 -1: ART +16 -1: isExtClassLoader +18 -1: Illegal Capacity: +26 -1: java/util/zip/ZipException +4 -1: /../ +34 -1: ([II)Ljava/util/Spliterator$OfInt; +26 -1: (I)Ljava/util/Enumeration; +60 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodType; +43 -1: not a field or nested class, no simple type +12 -1: nextPutIndex +15 -1: getConstructor0 +3 -1: AST +11 -1: fromURIPath +49 -1: (Ljava/util/Collections$UnmodifiableCollection;)V +8 -1: makeImpl +51 -1: (Ljava/util/WeakHashMap;Ljava/util/WeakHashMap$1;)V +32 -1: (Ljava/util/function/Supplier;)V +20 -1: namedFunctionInvoker +37 -1: newGetBooleanIllegalArgumentException +19 -1: (Ljava/io/File;ZI)V +8 -1: NULL_KEY +36 -1: Ljava/lang/reflect/Constructor; +21 -1: (Ljava/lang/Object;)B +21 -1: (Ljava/lang/Object;)C +21 -1: (Ljava/lang/Object;)D +21 -1: (Ljava/lang/Object;)F +30 -1: ()Lsun/util/locale/BaseLocale; +21 -1: (Ljava/lang/Object;)I +21 -1: (Ljava/lang/Object;)J +10 -1: lineNumber +95 -1: (JLjava/util/function/ToDoubleBiFunction<-TK;-TV;>;DLjava/util/function/DoubleBinaryOperator;)D +16 -1: CoderResult.java +44 -1: (Ljava/util/NavigableSet;Ljava/lang/Class;)V +21 -1: (Ljava/lang/Object;)S +13 -1: getNameString +129 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;Ljava/lang/invoke/DirectMethodHandle$1;)V +21 -1: (Ljava/lang/Object;)V +21 -1: (Ljava/lang/Object;)Z +81 -1: Ljava/util/HashMap;>; +49 -1: java/util/concurrent/locks/ReentrantLock$FairSync +11 -1: csisolatin0 +11 -1: csisolatin1 +7 -1: isSpace +10 -1: getDefault +11 -1: csisolatin2 +16 -1: ()Ljava/net/URL; +11 -1: csisolatin4 +14 -1: invokeExact_MT +11 -1: csisolatin5 +28 -1: (Ljava/io/FileInputStream;)V +11 -1: csisolatin9 +8 -1: isLetter +15 -1: getConstructors +21 -1: mainAppContextDefault +29 -1: ()[Ljava/lang/reflect/Method; +23 -1: Ljava/util/WeakHashMap; +12 -1: LF_INVSTATIC +17 -1: DirectBuffer.java +10 -1: newEncoder +10 -1: getVersion +32 -1: java/lang/IllegalAccessException +20 -1: java/util/Collection +61 -1: (Ljava/util/concurrent/ConcurrentHashMap;Ljava/lang/Object;)V +19 -1: $deserializeLambda$ +8 -1: removeIf +25 -1: sun/reflect/FieldAccessor +129 -1: ;>(Ljava/util/function/Function<-TT;+TU;>;Ljava/util/Comparator<-TU;>;)Ljava/util/Comparator; +17 -1: parseAbsoluteSpec +37 -1: ([Ljava/util/HashMap$Node;I)V +17 -1: java/util/HashSet +13 -1: spreadInvoker +20 -1: suppressAccessChecks +32 -1: Ljava/lang/InterruptedException; +11 -1: oldMappings +9 -1: lookupTag +16 -1: java/lang/System +5 -1: LFI: +6 -1: IBM737 +9 -1: SHORT_IDS +45 -1: ([IIILjava/util/function/IntBinaryOperator;)V +20 -1: getMetaInfEntryNames +10 -1: isReadOnly +50 -1: ()Ljava/util/SortedSet; +12 -1: java.vm.name +30 -1: java/lang/Class$AnnotationData +61 -1: (ILjava/lang/invoke/LambdaForm;)Ljava/lang/invoke/LambdaForm; +7 -1: address +44 -1: (Ljava/util/function/BiConsumer<-TK;-TV;>;)V +58 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;I)V +112 -1: (Ljava/lang/Object;TV;Ljava/lang/ref/ReferenceQueue;ILjava/util/WeakHashMap$Entry;)V +14 -1: aliases_KOI8_R +3 -1: AWT +14 -1: aliases_KOI8_U +24 -1: ARRAY_DOUBLE_BASE_OFFSET +23 -1: Ljava/util/jar/JarFile; +91 -1: (Ljava/lang/Class;[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B)V +14 -1: mappingAddress +19 -1: [Ljava/lang/Object; +17 -1: sun/misc/JarIndex +9 -1: image/jpg +49 -1: (Ljava/lang/String;I)Lsun/util/calendar/ZoneInfo; +37 -1: java/lang/invoke/DirectMethodHandle$1 +34 -1: java/util/Collections$SingletonMap +89 -1: (JLjava/util/function/ToIntBiFunction<-TK;-TV;>;ILjava/util/function/IntBinaryOperator;)I +46 -1: (Ljava/util/Comparator;)Ljava/util/Comparator; +11 -1: isTitleCase +38 -1: java/lang/IllegalMonitorStateException +33 -1: java/nio/BufferUnderflowException +28 -1: java/lang/ClassValue$Version +11 -1: printLocale +13 -1: STORE_BARRIER +42 -1: ([ILjava/util/function/IntUnaryOperator;)V +26 -1: sun/util/locale/BaseLocale +29 -1: java/io/ObjectStreamException +41 -1: sun/reflect/UnsafeStaticFieldAccessorImpl +60 -1: ([Ljava/lang/Object;Ljava/util/Iterator;)[Ljava/lang/Object; +30 -1: (Ljava/nio/charset/Charset;)[B +73 -1: ([Ljava/lang/String;[Ljava/lang/String;Ljava/io/File;)Ljava/lang/Process; +3 -1: VST +80 -1: Java(TM) SE Runtime Environment (build 1.8.0-internal-iklam_2013_11_27_21_25-b00 +85 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/net/URLStreamHandler;)V +20 -1: getStackTraceElement +36 -1: java/util/LinkedHashMap$LinkedKeySet +17 -1: getNormalizedYear +15 -1: maxBytesPerChar +16 -1: java/util/Random +34 -1: (I[C)Ljava/lang/invoke/LambdaForm; +11 -1: nbits < 0: +7 -1: H_PCHAR +29 -1: (Ljava/nio/charset/Charset;)I +36 -1: (I[I[C)Ljava/lang/invoke/LambdaForm; +23 -1: java/lang/ClassLoader$1 +23 -1: java/lang/ClassLoader$2 +23 -1: java/lang/ClassLoader$3 +9 -1: sizeTable +36 -1: (Z)Ljava/lang/AbstractStringBuilder; +29 -1: (Ljava/nio/charset/Charset;)V +25 -1: ARRAY_BOOLEAN_INDEX_SCALE +29 -1: (Ljava/nio/charset/Charset;)Z +6 -1: keySet +20 -1: declaredConstructors +25 -1: oracle/jrockit/jfr/Timing +12 -1: sizeIsSticky +6 -1: IBM775 +17 -1: currentTimeMillis +28 -1: java/nio/DirectDoubleBufferS +71 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/invoke/MethodType;B)V +28 -1: java/nio/DirectDoubleBufferU +19 -1: cachedFixedDateJan1 +15 -1: getClassContext +65 -1: (Ljava/security/CodeSource;Ljava/security/PermissionCollection;)V +16 -1: unmodifiableList +10 -1: getDoubleB +82 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/String; +11 -1: getEntryCrc +10 -1: getDoubleL +20 -1: (C)Ljava/lang/Class; +11 -1: Null action +22 -1: java/io/BufferedWriter +67 -1: (Ljava/lang/String;[Ljava/lang/Class<*>;)Ljava/lang/reflect/Method; +22 -1: parseSelectAnnotations +6 -1: rename +20 -1: acquireFieldAccessor +43 -1: (Ljava/util/Vector;[Ljava/lang/Object;III)V +32 -1: Ljava/lang/NullPointerException; +29 -1: (Ljava/lang/ThreadLocal<*>;)V +18 -1: descendingIterator +37 -1: java/util/Collections$SynchronizedSet +24 -1: mark/reset not supported +12 -1: ) > toIndex( +13 -1: <> +10 -1: fastRemove +4 -1: load +31 -1: sun/reflect/ReflectionFactory$1 +39 -1: (Ljava/util/List<*>;)Ljava/lang/Object; +39 -1: Ljava/util/Map; +9 -1: offerLast +31 -1: ()Ljava/lang/invoke/MethodType; +40 -1: Ljava/lang/Object; +17 -1: getObjectVolatile +14 -1: suspendThreads +55 -1: (Ljava/lang/String;ZLjava/util/Set;)Lsun/misc/Resource; +75 -1: (Ljava/util/List<+Ljava/lang/Comparable<-TT;>;>;TT;)I +6 -1: Lookup +20 -1: java/io/OutputStream +41 -1: Could not create application class loader +28 -1: Lsun/misc/JavaUtilJarAccess; +46 -1: java/util/Collections$SynchronizedNavigableSet +8 -1: override +21 -1: threadLocalRandomSeed +10 -1: TEXT_PLAIN +22 -1: ([B)Ljava/lang/String; +29 -1: java/nio/InvalidMarkException +14 -1: Throwable.java +27 -1: newWrongMethodTypeException +6 -1: ptypes +8 -1: bugLevel +62 -1: (ILjava/lang/CharSequence;II)Ljava/lang/AbstractStringBuilder; +37 -1: ()Ljava/util/Locale$LocaleNameGetter; +14 -1: getEntryMethod +7 -1: getByte +12 -1: UTF-32BE-BOM +4 -1: lock +34 -1: java/security/AccessControlContext +79 -1: (Ljava/lang/String;Ljava/lang/invoke/MethodType;I)Ljava/lang/invoke/MemberName; +5 -1: DEBUG +5 -1: unbox +17 -1: CLASSPATH_OPTOSFT +4 -1: cbrt +21 -1: LocalizedObjectGetter +21 -1: ProtectionDomain.java +22 -1: ([J)Ljava/util/BitSet; +17 -1: getUnresolvedName +34 -1: (Ljava/util/Map;Ljava/util/Map;I)V +7 -1: cskoi8r +14 -1: getInterfaces0 +48 -1: (Lsun/net/www/MessageHeader;)[Ljava/lang/String; +14 -1: getFileNameMap +16 -1: preserveCombiner +19 -1: getDefaultUseCaches +57 -1: (Ljava/lang/Class;[B[Ljava/lang/Object;)Ljava/lang/Class; +21 -1: (D)Ljava/lang/Double; +15 -1: iso8859_15_fdis +23 -1: java/util/regex/Pattern +6 -1: ibm912 +14 -1: findBuiltinLib +42 -1: java/lang/annotation/AnnotationFormatError +6 -1: ibm914 +6 -1: ibm915 +44 -1: java/nio/charset/IllegalCharsetNameException +22 -1: COMBINING_SPACING_MARK +20 -1: ()Ljava/lang/Thread; +8 -1: readLine +12 -1: (unresolved +65 -1: (Ljava/lang/String;Z)Ljava/util/Enumeration; +41 -1: ([Ljava/lang/String;[Ljava/lang/String;)V +30 -1: java/lang/Class$ReflectionData +8 -1: requests +52 -1: (Ljava/nio/charset/Charset;Lsun/nio/cs/US_ASCII$1;)V +12 -1: ACCESS_WRITE +6 -1: ibm920 +12 -1: CR_ERROR_MIN +6 -1: jarMap +6 -1: ibm923 +15 -1: java/lang/Error +11 -1: VM_SETTINGS +18 -1: name can't be null +7 -1: PRESENT +19 -1: setSecurityManager0 +101 -1: (Ljava/nio/channels/WritableByteChannel;Ljava/nio/charset/CharsetEncoder;I)Lsun/nio/cs/StreamEncoder; +25 -1: ()Ljava/util/jar/JarFile; +26 -1: java/io/ObjectOutputStream +13 -1: no !/ in spec +5 -1: (II)C +12 -1: setPriority0 +30 -1: (Z)[Ljava/lang/reflect/Method; +28 -1: sun/nio/cs/ThreadLocalCoders +5 -1: (II)I +22 -1: java/io/BufferedReader +26 -1: ()Lsun/misc/JavaNetAccess; +10 -1: Asia/Dhaka +14 -1: parallelStream +5 -1: (II)V +5 -1: (II)Z +31 -1: Ljava/lang/reflect/Constructor; +21 -1: ()Ljava/time/Instant; +31 -1: (Ljava/lang/String;III[J[I[IZ)V +8 -1: Volatile +23 -1: isUnicodeIdentifierPart +27 -1: longPrimitiveParameterCount +16 -1: Map is non-empty +24 -1: getLocalizedOutputStream +14 -1: java/lang/Byte +10 -1: staticBase +11 -1: lastElement +17 -1: replaceStaleEntry +17 -1: MAX_LOW_SURROGATE +28 -1: java.launcher.X.macosx.usage +20 -1: registerShutdownHook +16 -1: SECOND_IN_MILLIS +8 -1: Embedded +16 -1: BootstrapMethods +14 -1: numInvocations +79 -1: (Ljava/util/Collection;)Ljava/util/Enumeration; +10 -1: rotateLeft +46 -1: ([Ljava/lang/Object;)Ljava/util/stream/Stream; +6 -1: verify +17 -1: OTHER_PUNCTUATION +26 -1: acquireConstructorAccessor +38 -1: (Ljava/lang/String;I)Ljava/lang/Class; +30 -1: java/net/UnknownContentHandler +20 -1: PREFIX_LENGTH_OFFSET +12 -1: nextGetIndex +14 -1: standardOffset +10 -1: entryNames +15 -1: application/xml +3 -1: BET +39 -1: ([DIII)Ljava/util/Spliterator$OfDouble; +83 -1: (JLjava/util/function/BiFunction;Ljava/util/function/BiFunction;)Ljava/lang/Object; +10 -1: initMethod +47 -1: (Ljava/util/LinkedList$Node;)Ljava/lang/Object; +8 -1: isSealed +12 -1: isAccessible +11 -1: audio/x-wav +46 -1: (Ljava/lang/String;)Ljava/util/jar/Attributes; +24 -1: ()Ljava/io/OutputStream; +15 -1: FIELD_MODIFIERS +30 -1: sun/misc/URLClassPath$Loader$1 +20 -1: recursive invocation +34 -1: (Ljava/lang/String;)Ljava/net/URL; +12 -1: linkNodeLast +34 -1: call site initialization exception +17 -1: casAnnotationType +8 -1: x-ibm874 +7 -1: isUpper +58 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesTask +31 -1: Ill-formed Unicode locale key: +12 -1: defineClass0 +12 -1: defineClass1 +12 -1: defineClass2 +59 -1: Can not call newInstance() on the Class for java.lang.Class +10 -1: codePoints +3 -1: ... +14 -1: readAheadLimit +14 -1: parallelSetAll +41 -1: ([Ljava/lang/Object;I)[Ljava/lang/Object; +148 -1: (Ljava/lang/Throwable$PrintStreamOrWriter;[Ljava/lang/StackTraceElement;Ljava/lang/String;Ljava/lang/String;Ljava/util/Set;)V +10 -1: Deque.java +21 -1: Must be volatile type +7 -1: setForm +58 -1: Ljava/lang/Number;Ljava/lang/Comparable; +47 -1: (Ljava/lang/String;Ljava/security/CodeSource;)V +30 -1: java/io/InterruptedIOException +44 -1: java/util/Collections$SynchronizedCollection +16 -1: Invalid Jar file +32 -1: sun/util/calendar/CalendarSystem +67 -1: (JLsun/util/calendar/CalendarDate;)Lsun/util/calendar/CalendarDate; +19 -1: DEFAULT_BUFFER_SIZE +16 -1: readObjectNoData +16 -1: setJavaNioAccess +73 -1: (Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/Object;)Ljava/lang/Object; +14 -1: copyToIntArray +10 -1: hasWaiters +20 -1: (I)Ljava/lang/Class; +35 -1: all turn on all debugging +14 -1: Invalid host: +26 -1: Lsun/nio/cs/StreamEncoder; +43 -1: sun/misc/JavaSecurityProtectionDomainAccess +11 -1: getNamedCon +8 -1: H_SERVER +27 -1: java/util/function/Consumer +12 -1: isLocalClass +81 -1: (Ljava/util/LinkedHashMap$Entry;Ljava/util/LinkedHashMap$Entry;)V +83 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Comparable; +4 -1: exec +43 -1: java/lang/reflect/InvocationTargetException +35 -1: (Ljava/io/File;Ljava/lang/String;)V +9 -1: modifiers +35 -1: (Ljava/io/File;Ljava/lang/String;)Z +9 -1: Byte.java +12 -1: unknown mode +18 -1: initializeVerifier +24 -1: (Ljava/nio/ByteBuffer;)I +22 -1: ([Ljava/lang/Object;)I +11 -1: correctType +6 -1: escape +52 -1: (Ljava/security/ProtectionDomain;)Ljava/lang/String; +11 -1: annotations +121 -1: (Ljava/lang/Class;ILjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName; +22 -1: using an instance of +14 -1: getSpeciesData +28 -1: ()Ljava/security/CodeSource; +12 -1: JZENTRY_NAME +24 -1: (Ljava/nio/ByteBuffer;)V +4 -1: ZBSC +22 -1: ([Ljava/lang/Object;)V +7 -1: isParam +165 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/lang/String; +70 -1: (ILjava/util/List;>;)Ljava/lang/invoke/LambdaForm; +24 -1: Ljava/io/FilePermission; +22 -1: ([Ljava/lang/Object;)Z +11 -1: mergeHeader +11 -1: applyAsLong +28 -1: (IJ)Ljava/lang/StringBuffer; +10 -1: arityCheck +52 -1: (ILjava/lang/Class<*>;)Ljava/lang/invoke/MethodType; +13 -1: toUpperCaseEx +9 -1: nextIndex +11 -1: start > end +4 -1: long +6 -1: Static +27 -1: ()Ljava/lang/reflect/Field; +10 -1: bufUpdater +43 -1: averageBytesPerChar exceeds maxBytesPerChar +105 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Lsun/util/locale/BaseLocale$1;)V +23 -1: ARRAY_SHORT_INDEX_SCALE +15 -1: getHeaderFields +36 -1: java/util/HashMap$HashMapSpliterator +10 -1: Guard.java +29 -1: java/util/RandomAccessSubList +6 -1: addAll +7 -1: getTime +16 -1: invokeHandleForm +32 -1: sun/util/locale/LocaleExtensions +16 -1: checkAndLoadMain +19 -1: INTERFACE_MODIFIERS +11 -1: resolveName +20 -1: getContentLengthLong +53 -1: (ICLjava/lang/Object;)Ljava/lang/invoke/MethodHandle; +19 -1: name cannot be null +23 -1: hasReceiverTypeDispatch +12 -1: getExtension +49 -1: Ljava/util/Set; +114 -1: (Ljava/lang/String;[J[I[J[I[Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;)Lsun/util/calendar/ZoneInfo; +24 -1: NativeSignalHandler.java +58 -1: (Ljava/lang/Thread;)Ljava/lang/ThreadLocal$ThreadLocalMap; +10 -1: interface +68 -1: (Ljava/lang/String;)Ljava/lang/invoke/BoundMethodHandle$SpeciesData; +15 -1: addShutdownHook +32 -1: java/security/AccessController$1 +10 -1: filterTags +19 -1: [Ljava/lang/Number; +92 -1: (Ljava/util/function/ToLongFunction<-TT;>;)Ljava/util/Comparator; +43 -1: java/util/LinkedHashMap$LinkedEntryIterator +5 -1: utf-8 +11 -1: iso-8859-13 +11 -1: iso-8859-15 +58 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/util/jar/JarFile; +41 -1: CertPathValidator debugging +22 -1: ARRAY_LONG_BASE_OFFSET +57 -1: (Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/Object; +13 -1: queuePrintJob +14 -1: Watchable.java +15 -1: jdkMajorVersion +62 -1: (Ljava/lang/String;ZJJ)Ljava/lang/management/MemoryPoolMXBean; +23 -1: twoToTheDoubleScaleDown +22 -1: registerVMNotification +30 -1: ()Lsun/misc/JavaUtilJarAccess; +17 -1: getTargetVolatile +4 -1: exit +13 -1: StringDecoder +12 -1: hasRemaining +9 -1: bigEndian +14 -1: checkMulticast +13 -1: clearProperty +18 -1: ForEachMappingTask +15 -1: Collection.java +55 -1: (Ljava/io/InputStream;)Ljava/security/cert/Certificate; +5 -1: UTF-8 +11 -1: transitions +7 -1: wrapAlt +27 -1: ClassNotFoundException.java +20 -1: UnresolvedPermission +14 -1: charsetForName +9 -1: getParent +18 -1: [Ljava/lang/Short; +24 -1: UnmodifiableNavigableMap +5 -1: xflow +10 -1: interfaces +19 -1: doubleToRawLongBits +73 -1: (Ljava/lang/reflect/Constructor<*>;[Ljava/lang/Object;)Ljava/lang/Object; +10 -1: getInCheck +21 -1: (Ljava/lang/Thread;)V +15 -1: fromIndex < 0: +63 -1: (ITK;TV;Ljava/util/concurrent/ConcurrentHashMap$Node;)V +9 -1: pollFirst +21 -1: (Ljava/lang/Thread;)Z +16 -1: checkProxyMethod +39 -1: generateLambdaFormInterpreterEntryPoint +15 -1: findLoadedClass +6 -1: system +5 -1: ITALY +45 -1: combiner SubjectDomainCombiner debugging +34 -1: NativeConstructorAccessorImpl.java +22 -1: ([C)Ljava/lang/String; +39 -1: (Ljava/lang/String;Ljava/lang/Class;Z)V +18 -1: java/lang/Thread$1 +20 -1: window can't be null +10 -1: Debug.java +17 -1: singletonIterator +53 -1: java/util/concurrent/ConcurrentHashMap$ForEachKeyTask +20 -1: java/security/Policy +13 -1: getDescriptor +32 -1: (I)Ljava/lang/invoke/MethodType; +15 -1: nativeLibraries +27 -1: sun/util/locale/LanguageTag +8 -1: priority +12 -1: IntegerCache +14 -1: connectTimeout +9 -1: namePairs +17 -1: vmAllowSuspension +16 -1: METHOD_MODIFIERS +51 -1: (Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType; +20 -1: MIN_TREEIFY_CAPACITY +13 -1: getEntryBytes +33 -1: ()Lsun/reflect/ReflectionFactory; +17 -1: getDisplayCountry +13 -1: isWrapperType +5 -1: utf16 +12 -1: parallelSort +27 -1: (Ljava/nio/ByteBuffer;IIZ)V +56 -1: (Ljava/lang/Class;Ljava/lang/Class;ILjava/lang/Class;I)Z +9 -1: isDefined +20 -1: sun/misc/FloatConsts +10 -1: putDoubleB +30 -1: java/lang/NoSuchFieldException +27 -1: Value out of range. Value:" +36 -1: sun/reflect/NativeMethodAccessorImpl +7 -1: decoder +38 -1: ([Ljava/lang/invoke/MutableCallSite;)V +10 -1: putDoubleL +68 -1: (Ljava/lang/reflect/Method;)Lsun/reflect/generics/scope/MethodScope; +37 -1: java/lang/invoke/MethodHandles$Lookup +9 -1: Void.java +28 -1: sun/util/locale/BaseLocale$1 +10 -1: stackTrace +7 -1: toClass +11 -1: access$1500 +41 -1: (Ljava/lang/Object;I)Ljava/lang/Class<*>; +148 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;Ljava/lang/Object;JLjava/lang/invoke/DirectMethodHandle$1;)V +22 -1: ARRAY_BYTE_BASE_OFFSET +13 -1: ZipEntry.java +56 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/util/List; +5 -1: utf32 +16 -1: ISO_646.irv:1991 +5 -1: p-126 +20 -1: sun.net.www.protocol +3 -1: key +20 -1: IMPLEMENTATION_TITLE +93 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;)Lsun/util/locale/LanguageTag; +66 -1: ([Ljava/lang/Object;[Ljava/lang/Object;IIILjava/util/Comparator;)V +27 -1: java/nio/DirectFloatBufferS +27 -1: java/nio/DirectFloatBufferU +15 -1: JZENTRY_COMMENT +8 -1: casTabAt +10 -1: getVariant +24 -1: Ljava/lang/Thread$State; +35 -1: ()Ljava/lang/AbstractStringBuilder; +114 -1: (Ljava/security/CodeSource;Ljava/security/PermissionCollection;Ljava/lang/ClassLoader;[Ljava/security/Principal;)V +16 -1: getShortVolatile +18 -1: SoftReference.java +3 -1: BST +12 -1: isCastableTo +28 -1: sun.zip.disableMemoryMapping +11 -1: copyOfRange +17 -1: ()Lsun/misc/Perf; +59 -1: (Ljava/lang/String;[Ljava/io/File;Ljava/lang/ClassLoader;)V +27 -1: (Lsun/misc/JavaAWTAccess;)V +8 -1: DECLARED +18 -1: loadedLibraryNames +6 -1: CENNAM +7 -1: encprop +5 -1: ABASE +27 -1: java/util/WeakHashMap$Entry +13 -1: wrapWithPrims +5 -1: UTF32 +29 -1: Ljava/net/URISyntaxException; +6 -1: groups +65 -1: (Ljava/util/Set<+TT;>;)Ljava/util/Set; +32 -1: lambda$comparingByKey$6d558cbf$1 +15 -1: removeElementAt +49 -1: [Ljava/util/concurrent/ConcurrentHashMap$Segment; +32 -1: Sign character in wrong position +6 -1: IBM819 +39 -1: java/security/cert/CertificateException +4 -1: join +30 -1: Ljava/lang/invoke/ForceInline; +14 -1: expandCapacity +19 -1: Ljava/lang/Integer; +11 -1: NUMBER_THAI +10 -1: getExtURLs +9 -1: retainAll +21 -1: (S)Ljava/lang/String; +8 -1: truncate +51 -1: java/util/ArraysParallelSortHelpers$FJObject$Sorter +28 -1: newIndexOutOfBoundsException +26 -1: JavaUtilJarAccessImpl.java +22 -1: (II)Ljava/util/BitSet; +10 -1: getLongAt0 +65 -1: (Ljava/lang/Class;)TA; +26 -1: (Ljava/lang/ThreadLocal;)I +5 -1: (J)[B +27 -1: Ljava/lang/CharacterData00; +18 -1: sun/misc/Cleaner$1 +59 -1: (Ljava/util/List;Ljava/lang/Object;Ljava/util/Comparator;)I +114 -1: (JLjava/util/function/ToDoubleFunction;>;DLjava/util/function/DoubleBinaryOperator;)D +28 -1: java/lang/ClassCastException +26 -1: (Ljava/lang/ThreadLocal;)V +27 -1: ()[Ljava/lang/reflect/Type; +13 -1: not invoker: +56 -1: (Ljava/net/URL;Ljava/net/Proxy;)Ljava/net/URLConnection; +6 -1: before +37 -1: ([DII)Ljava/util/stream/DoubleStream; +9 -1: logicalOr +9 -1: IS_METHOD +12 -1: SPACE_USABLE +12 -1: lastModified +10 -1: setSigners +8 -1: Invokers +7 -1: nCopies +12 -1: utf-32le-bom +7 -1: (IIII)J +17 -1: jdkSpecialVersion +26 -1: ()Ljava/lang/StringBuffer; +17 -1: SearchEntriesTask +14 -1: java/net/Parts +20 -1: Ljava/lang/Runnable; +35 -1: java/util/WeakHashMap$ValueIterator +19 -1: FinalReference.java +7 -1: (IIII)V +23 -1: Ljava/lang/ThreadGroup; +10 -1: nullsFirst +8 -1: setCache +55 -1: (Ljava/util/List;Ljava/lang/Object;Ljava/lang/Object;)Z +24 -1: java/util/SimpleTimeZone +6 -1: IBM850 +6 -1: IBM852 +25 -1: sun/net/www/MeteredStream +4 -1: exts +6 -1: IBM855 +16 -1: allocateElements +6 -1: IBM857 +19 -1: setDefaultUseCaches +6 -1: IBM858 +5 -1: slice +9 -1: marklimit +77 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction; +32 -1: java/util/Collections$CheckedSet +12 -1: getModifiers +8 -1: protocol +10 -1: getInteger +33 -1: ([J)Ljava/util/stream/LongStream; +6 -1: IBM862 +8 -1: Map.java +35 -1: java/lang/Class$EnclosingMethodInfo +25 -1: (J)Ljava/math/BigInteger; +31 -1: (Ljava/net/URL;Ljava/io/File;)V +6 -1: IBM866 +6 -1: unload +28 -1: sun/invoke/util/VerifyAccess +105 -1: ()Ljava/util/Map;Ljava/lang/annotation/Annotation;>; +25 -1: Resetting to invalid mark +20 -1: java/util/Vector$Itr +5 -1: SHIFT +11 -1: NonfairSync +18 -1: getSecurityManager +34 -1: ()[Ljava/lang/ClassValue$Entry<*>; +28 -1: (J)Ljava/lang/StringBuilder; +28 -1: (Ljava/security/PublicKey;)V +12 -1: getResources +6 -1: IBM874 +27 -1: which Java does not define +36 -1: (Ljava/lang/invoke/MethodTypeForm;)V +48 -1: array length is not legal for long[] or double[] +18 -1: IS_FIELD_OR_METHOD +7 -1: Aliases +17 -1: checkedExceptions +13 -1: getDayOfMonth +51 -1: (Ljava/util/Spliterator;Z)Ljava/util/stream/Stream; +20 -1: java/io/EOFException +26 -1: Enclosing method not found +17 -1: flushLeftoverChar +122 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B)Ljava/lang/reflect/Constructor<*>; +18 -1: buildAnnotatedType +21 -1: setContextClassLoader +22 -1: java/io/UnixFileSystem +20 -1: nonSyncContentEquals +43 -1: java/util/Collections$SynchronizedSortedMap +15 -1: Properties.java +35 -1: com.oracle.usagetracker.config.file +13 -1: java/util/Map +18 -1: setEagerValidation +13 -1: getSetMessage +6 -1: unlock +14 -1: refKindIsField +22 -1: bad field type alias: +17 -1: casAnnotationData +6 -1: AUGUST +106 -1: (Ljava/util/concurrent/CountedCompleter;[Ljava/lang/Object;[Ljava/lang/Object;IIIILjava/util/Comparator;)V +11 -1: monitorExit +17 -1: linkMethodTracing +69 -1: (Ljava/lang/String;Ljava/lang/String;Lsun/util/locale/BaseLocale$1;)V +21 -1: java/lang/ClassLoader +39 -1: PKCS11 KeyStore debugging +10 -1: checkRtype +25 -1: getLocalGregorianCalendar +23 -1: GenericDeclaration.java +12 -1: isViewableAs +22 -1: static_oop_field_count +72 -1: (Ljava/util/function/ToDoubleFunction<-TT;>;)Ljava/util/Comparator; +11 -1: languageKey +6 -1: Class +34 -1: java/util/HashMap$ValueSpliterator +37 -1: (IJ)Ljava/lang/AbstractStringBuilder; +17 -1: privilegedContext +36 -1: java/util/LinkedHashMap$LinkedValues +11 -1: getHostName +10 -1: beginEntry +7 -1: isAlpha +61 -1: (Ljava/lang/invoke/MethodType;I)Ljava/lang/invoke/LambdaForm; +10 -1: expandArgs +14 -1: Finalizer.java +14 -1: timeDefinition +28 -1: ()Ljava/util/jar/Attributes; +14 -1: ansi_x3.4-1968 +11 -1: setPriority +23 -1: (C)Ljava/lang/Class<*>; +26 -1: (Ljava/lang/Object;TV;)TV; +70 -1: (Ljava/util/function/BiFunction;Ljava/lang/Object;Ljava/lang/Object;)V +48 -1: ()Lsun/reflect/generics/factory/GenericsFactory; +25 -1: java/lang/invoke/CallSite +8 -1: tzdb.dat +17 -1: containsAllLimits +17 -1: fileNameMapLoaded +6 -1: values +17 -1: setLastAccessTime +12 -1: expandFromVM +50 -1: java/lang/invoke/MethodHandle$PolymorphicSignature +3 -1: .EC +14 -1: access denied +22 -1: java/util/AbstractList +47 -1: (IILjava/lang/String;)Ljava/lang/StringBuilder; +52 -1: ()Lsun/reflect/generics/repository/MethodRepository; +22 -1: (Ljava/lang/String;)[B +57 -1: (Ljava/lang/Object;)Ljava/lang/invoke/DirectMethodHandle; +18 -1: compareAndSwapLong +4 -1: != +6 -1: StdArg +29 -1: (Ljava/security/Permission;)V +22 -1: ([D)Ljava/lang/String; +28 -1: Lsun/reflect/MethodAccessor; +14 -1: ansi_x3.4-1986 +20 -1: getPeakFinalRefCount +29 -1: (Ljava/security/Permission;)Z +5 -1: debug +38 -1: (Ljava/lang/reflect/Constructor<*>;)[B +27 -1: java/util/GregorianCalendar +16 -1: Null replacement +26 -1: ()Ljava/lang/reflect/Type; +28 -1: DIRECTIONALITY_LEFT_TO_RIGHT +102 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Lsun/util/locale/BaseLocale; +15 -1: isConvertibleTo +24 -1: ARRAY_DOUBLE_INDEX_SCALE +16 -1: getComponentType +29 -1: sun/util/locale/LocaleMatcher +11 -1: LOCALECACHE +6 -1: UNWRAP +16 -1: AbstractSet.java +3 -1: CAT +36 -1: java/lang/annotation/RetentionPolicy +14 -1: getParameters0 +8 -1: .Handler +33 -1: Ljava/lang/IllegalStateException; +10 -1: RAW_RETURN +20 -1: java/lang/ClassValue +16 -1: getDisplayString +152 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;I)Ljava/util/concurrent/ConcurrentHashMap$Node; +67 -1: ()Ljava/util/Map; +214 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object; +33 -1: java/lang/invoke/SerializedLambda +42 -1: ([Ljava/lang/Object;II)[Ljava/lang/Object; +22 -1: java/util/zip/ZipUtils +9 -1: setDaemon +26 -1: java/net/HttpURLConnection +6 -1: mkdirs +20 -1: (Ljava/io/Reader;I)V +28 -1: (IC)Ljava/lang/StringBuffer; +45 -1: ([Ljava/lang/Class<*>;I)[Ljava/lang/Class<*>; +29 -1: java/lang/invoke/MethodHandle +28 -1: sun/misc/CompoundEnumeration +6 -1: setVal +23 -1: INTERNED_ARGUMENT_LIMIT +4 -1: NULL +49 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class;)Z +43 -1: java/util/Collections$UnmodifiableSortedMap +39 -1: (Ljava/lang/Object;Ljava/lang/Object;)I +6 -1: ([JJ)I +19 -1: java/io/PrintWriter +25 -1: ()Ljava/lang/ThreadGroup; +5 -1: (IJ)J +16 -1: onMalformedInput +15 -1: decrementAndGet +11 -1: -2147483648 +6 -1: reduce +12 -1: asCharBuffer +39 -1: (Ljava/lang/Object;Ljava/lang/Object;)V +44 -1: (Ljava/util/SortedSet;)Ljava/util/SortedSet; +9 -1: backtrace +3 3: Bar +47 -1: ()Lsun/misc/JavaSecurityProtectionDomainAccess; +39 -1: (Ljava/lang/Object;Ljava/lang/Object;)Z +5 -1: (IJ)V +6 -1: ([JJ)V +22 -1: ([Ljava/lang/Thread;)I +5 -1: (IJ)Z +7 -1: ([BII)I +79 -1: (Ljava/util/Comparator<-TT;>;)Ljava/util/Comparator; +12 -1: getUnchecked +10 -1: getBaseURL +36 -1: (Ljava/lang/Object;)Ljava/util/List; +53 -1: (Ljava/util/function/Function;)Ljava/util/Comparator; +10 -1: getComment +7 -1: ([BII)V +30 -1: privateGetDeclaredConstructors +58 -1: (Ljava/lang/String;ZILjava/util/Locale;)Ljava/lang/String; +18 -1: unknown era name: +13 -1: invokeSpecial +9 -1: checkLink +16 -1: cspc8codepage437 +6 -1: stream +18 -1: sun/nio/cs/UTF_8$1 +18 -1: contextClassLoader +50 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;I)V +30 -1: sun/util/calendar/BaseCalendar +11 -1: enumeration +18 -1: key can't be empty +137 -1: (JLjava/util/function/Function;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU; +10 -1: getBoolean +5 -1: eetop +49 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/String; +43 -1: sun/reflect/generics/scope/ConstructorScope +13 -1: CANADA_FRENCH +39 -1: Ljava/nio/channels/ReadableByteChannel; +15 -1: java/lang/Float +29 -1: DIRECTIONALITY_OTHER_NEUTRALS +52 -1: (ZLjava/nio/charset/Charset;Ljava/io/OutputStream;)V +8 -1: appendTo +19 -1: PARAGRAPH_SEPARATOR +16 -1: (Unknown Source) +4 -1: tree +38 -1: (I[C)Ljava/lang/AbstractStringBuilder; +14 -1: VerifierStream +48 -1: (Ljava/util/Collection;Ljava/lang/Object;)V +15 -1: releaseInflater +20 -1: getHeaderNamesInList +17 -1: getSystemPackages +8 -1: teardown +6 -1: (BZI)I +10 -1: checkWrite +19 -1: JavaLangAccess.java +31 -1: Ljava/lang/ClassValue$Identity; +50 -1: (Ljava/util/concurrent/CountedCompleter;[S[SIIII)V +24 -1: getDeclaredConstructors0 +3 -1: /.. +3 -1: /./ +16 -1: hashCodeForCache +18 -1: Property settings: +26 -1: Illegal initial capacity: +10 -1: text/plain +61 -1: (Ljava/util/function/ToDoubleFunction;)Ljava/util/Comparator; +24 -1: createMemoryManagerMBean +10 -1: ,lastRule= +9 -1: GMT-00:00 +5 -1: mtime +40 -1: (Ljava/lang/String;I)[Ljava/lang/String; +11 -1: (TT;TV;)TV; +154 -1: (Ljava/lang/Class<*>;Ljava/lang/String;[Ljava/lang/Class<*>;Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B[B)Ljava/lang/reflect/Method; +41 -1: (Ljava/util/jar/JarFile;)Ljava/util/List; +43 -1: (JILjava/lang/Object;)Ljava/nio/ByteBuffer; +19 -1: MethodTypeForm.java +21 -1: java/util/jar/JarFile +30 -1: java/lang/Integer$IntegerCache +22 -1: getDisplayVariantArray +6 -1: setAll +13 -1: ClassValueMap +52 -1: (Ljava/security/PublicKey;Ljava/security/Provider;)V +51 -1: java/util/concurrent/ConcurrentHashMap$BaseIterator +59 -1: (Ljava/lang/Runnable;Ljava/security/AccessControlContext;)V +100 -1: (Ljava/util/concurrent/ConcurrentMap;Ljava/util/function/BiFunction;)Ljava/util/function/BiConsumer; +8 -1: default +13 -1: compareAndSet +10 -1: iso8859-13 +9 -1: putShortB +14 -1: skipDelimiters +28 -1: URI has a fragment component +10 -1: iso8859-15 +42 -1: (Ljava/net/Proxy;)Ljava/net/URLConnection; +23 -1: needsPackageAccessCheck +9 -1: putShortL +3 -1: //[ +69 -1: (Ljava/security/AccessControlContext;Ljava/security/DomainCombiner;)V +18 -1: too many arguments +35 -1: ([III)Ljava/util/Spliterator$OfInt; +10 -1: CopiesList +10 -1: iso-8859-1 +9 -1: ([BII[C)I +10 -1: iso-8859-2 +11 -1: returnCount +10 -1: iso-8859-4 +10 -1: iso-8859-5 +8 -1: utf_16be +10 -1: iso-8859-7 +9 -1: isLimited +9 -1: parseByte +10 -1: iso-8859-9 +13 -1: , s.length() +10 -1: matchCerts +14 -1: RECURSIVE_CHAR +11 -1: reduceToInt +11 -1: displayName +9 -1: calendars +64 -1: (Ljava/lang/String;ZLjava/util/jar/JarEntry;)Lsun/misc/Resource; +11 -1: isProtected +78 -1: (Ljava/util/SortedMap;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/SortedMap; +4 -1: trim +20 -1: java/nio/FloatBuffer +17 -1: PreHashedMap.java +74 -1: Ljava/util/concurrent/ConcurrentMap; +22 -1: ([S)Ljava/lang/String; +19 -1: PrintStreamOrWriter +38 -1: java/util/Collections$EmptyEnumeration +22 -1: java/util/LinkedList$1 +13 -1: sunpkcs11.jar +25 -1: java/nio/DirectByteBuffer +96 -1: (ZLjava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle; +7 -1: isArray +43 -1: (Ljava/lang/String;)Ljava/util/Enumeration; +52 -1: java/lang/invoke/MethodHandleImpl$AsVarargsCollector +59 -1: (Ljava/lang/String;Lsun/misc/Resource;)Ljava/lang/Class<*>; +26 -1: setJavaNetHttpCookieAccess +15 -1: wrongTargetType +57 -1: java/util/concurrent/ConcurrentHashMap$ForEachMappingTask +33 -1: [Ljava/lang/reflect/TypeVariable; +5 -1: load0 +39 -1: (Ljava/lang/String;)Ljava/lang/Boolean; +21 -1: isHeldByCurrentThread +14 -1: outOfBoundsMsg +30 -1: Ljava/lang/ref/Reference$Lock; +11 -1: ISO-8859-13 +84 -1: (Ljava/lang/ClassValue;)Ljava/lang/ClassValue$Entry; +11 -1: ISO-8859-15 +40 -1: (Ljava/net/URL;)Ljava/net/URLConnection; +84 -1: ;>(Ljava/util/Collection<+TT;>;)TT; +38 -1: sun/reflect/generics/scope/MethodScope +5 -1: mutex +11 -1: loaderTypes +8 -1: defaults +22 -1: getActualTypeArguments +41 -1: DIRECTIONALITY_EUROPEAN_NUMBER_TERMINATOR +4 -1: keys +71 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType; +94 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;I)Ljava/lang/invoke/MethodHandle; +113 -1: Ljava/util/AbstractSet;Ljava/util/Set;Ljava/lang/Cloneable;Ljava/io/Serializable; +12 -1: checkConnect +39 -1: (Ljava/lang/String;Ljava/util/Locale;)V +26 -1: ([CII[C)Ljava/lang/String; +12 -1: isDoubleWord +37 -1: configparser JAAS ConfigFile parsing +27 -1: sun/misc/Perf$GetPerfAction +44 -1: (Ljava/util/Collections$UnmodifiableList;I)V +4 -1: acos +26 -1: java/nio/DirectLongBufferS +7 -1: (ITE;)V +14 -1: putIntVolatile +24 -1: setContentHandlerFactory +26 -1: java/nio/DirectLongBufferU +10 -1: fieldCount +11 -1: invokeBasic +50 -1: (Ljava/util/zip/ZipEntry;)Ljava/util/jar/JarEntry; +24 -1: java/util/Locale$Builder +9 -1: setParent +11 -1: asLifoQueue +33 -1: lambda$comparingDouble$8dcf42ea$1 +24 -1: (Ljava/lang/Throwable;)I +35 -1: (Lsun/misc/JavaUtilZipFileAccess;)V +49 -1: (ILjava/lang/Object;)Ljava/util/HashMap$TreeNode; +10 -1: CLASS_PATH +6 -1: tclass +11 -1: getExponent +23 -1: getAnnotatedReturnType0 +18 -1: checkPackageAccess +35 -1: Can not instantiate java.lang.Class +24 -1: (Ljava/lang/Throwable;)V +195 -1: (Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/BoundMethodHandle$SpeciesData;Ljava/lang/invoke/BoundMethodHandle$SpeciesData;)Ljava/lang/invoke/LambdaForm; +17 -1: Empty replacement +3 -1: .SF +14 -1: ByteOrder.java +39 -1: ()Lsun/util/calendar/BaseCalendar$Date; +35 -1: ()[Ljava/security/ProtectionDomain; +12 -1: setElementAt +30 -1: (Ljava/security/CodeSource;Z)Z +45 -1: (Ljava/lang/Class<*>;)Ljava/lang/ClassLoader; +52 -1: (Ljava/nio/charset/Charset;)Ljava/util/zip/ZipCoder; +13 -1: foldArguments +23 -1: java/time/LocalDateTime +30 -1: [Lsun/launcher/LauncherHelper; +16 -1: 0123456789abcdef +60 -1: (Ljava/util/Spliterator$OfInt;Z)Ljava/util/stream/IntStream; +33 -1: (ILjava/lang/String;IIIIIIIIIII)V +20 -1: DMH.newInvokeSpecial +28 -1: java/nio/charset/CoderResult +33 -1: sun/nio/cs/StandardCharsets$Cache +11 -1: saveConvert +14 -1: ExtClassLoader +12 -1: parentOrNull +20 -1: insertParameterTypes +32 -1: (II)Ljava/util/stream/IntStream; +13 -1: setStackTrace +20 -1: is not an enum type +3 -1: CNT +4 -1: host +85 -1: ([Ljava/lang/Object;Ljava/util/function/IntFunction;)Ljava/util/function/IntConsumer; +11 -1: batchRemove +8 -1: newField +16 5: sun/nio/cs/UTF_8 +104 -1: (Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;)Ljava/lang/invoke/LambdaForm$Name; +8 -1: saturday +35 -1: java/util/ArraysParallelSortHelpers +15 -1: java/util/Queue +40 -1: (Ljava/lang/Class<*>;)Ljava/lang/String; +7 -1: toChars +5 -1: first +17 -1: ArrayDecoder.java +30 -1: ()Lsun/reflect/MethodAccessor; +26 -1: thread group can't be null +13 -1: IllegalName: +32 -1: java/util/Collections$SetFromMap +14 -1: line.separator +17 -1: getDeclaredMethod +10 -1: getMinutes +35 -1: (Lsun/util/locale/BaseLocale$Key;)I +40 -1: ([Ljava/lang/String;)Ljava/lang/Process; +31 -1: Ljava/util/LinkedHashMap$Entry; +13 -1: , str.length +8 -1: getProbe +6 -1: ([DI)I +5 -1: (CI)I +23 -1: saveAndRemoveProperties +6 -1: rehash +3 -1: lcb +31 -1: Ljava/util/Arrays$NaturalOrder; +55 -1: (IILjava/lang/String;)Ljava/lang/AbstractStringBuilder; +10 -1: loadFactor +15 -1: putLongVolatile +34 -1: sun/misc/URLClassPath$FileLoader$1 +12 -1: Europe/Paris +8 -1: DECEMBER +86 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction; +22 -1: getImplMethodSignature +38 -1: Malformed enclosing method information +8 -1: maskNull +3 -1: lct +21 -1: CONSTRUCTOR_MODIFIERS +36 -1: ()Lsun/misc/JavaNetHttpCookieAccess; +12 -1: HashIterator +84 -1: (Ljava/lang/Class;Ljava/lang/Class$AnnotationData;Ljava/lang/Class$AnnotationData;)Z +33 -1: java/lang/Character$UnicodeScript +5 -1: toHex +27 -1: java/security/AllPermission +17 -1: appendReplacement +20 -1: SimpleImmutableEntry +18 -1: getRequestProperty +12 -1: compareCerts +44 -1: java/util/ArrayPrefixHelpers$IntCumulateTask +19 -1: makeSpreadArguments +222 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesTask;Ljava/util/function/Function;Ljava/util/function/BiFunction;)V +8 -1: addFirst +6 -1: nextUp +35 -1: (Ljava/net/ContentHandlerFactory;)V +40 -1: (Ljava/lang/String;)Ljava/lang/Class<*>; +23 -1: java/util/LocaleISOData +14 -1: PREPARED_FORMS +6 -1: FJByte +20 -1: getGenericSuperclass +6 -1: offset +16 -1: LocaleUtils.java +12 -1: isUnresolved +18 -1: aliases_ISO_8859_1 +18 -1: aliases_ISO_8859_2 +15 -1: isSurrogatePair +18 -1: aliases_ISO_8859_4 +18 -1: aliases_ISO_8859_5 +6 -1: EXTLEN +18 -1: aliases_ISO_8859_7 +15 -1: Comparator.java +18 -1: aliases_ISO_8859_9 +15 -1: ISO_8859-2:1987 +22 -1: Ljava/util/List<+TE;>; +16 -1: Unknown Category +3 -1: CST +51 -1: Ljava/util/AbstractList; +6 -1: FRIDAY +40 -1: (Ljava/lang/String;ZZ)Ljava/lang/String; +13 -1: isInterrupted +8 -1: utf_16le +89 -1: (BLjava/lang/Class<*>;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle; +22 -1: checkInvocationCounter +12 -1: EPOCH_OFFSET +35 -1: (JJILjava/nio/DirectByteBuffer$1;)V +7 -1: canRead +9 -1: getLoader +18 -1: publicConstructors +23 -1: factory already defined +33 -1: java/lang/ref/ReferenceQueue$Null +37 -1: (Ljava/util/List;Ljava/util/Random;)V +25 -1: setPackageAssertionStatus +20 -1: MapReduceEntriesTask +11 -1: OPEN_DELETE +35 -1: (Ljava/util/Set;Ljava/lang/Class;)V +9 -1: rootGroup +10 -1: updateForm +22 -1: JavaUtilJarAccess.java +3 -1: CTT +57 -1: (Lsun/reflect/MethodInfo;)Ljava/lang/reflect/Constructor; +82 -1: (Ljava/util/NavigableSet;)Ljava/util/NavigableSet; +13 -1: getReturnType +34 -1: java/util/HashMap$EntrySpliterator +14 -1: TIME_UNDEFINED +32 -1: com/sun/crypto/provider/AESCrypt +7 -1: H_DIGIT +20 -1: clearAssertionStatus +44 -1: java/lang/invoke/MethodHandleImpl$BindCaller +8 -1: scloader +6 -1: IBM923 +5 -1: read0 +5 -1: read1 +4 -1: true +9 -1: BA_HIDDEN +16 -1: jvmUpdateVersion +36 -1: java/lang/StringCoding$StringDecoder +37 -1: (J)Ljava/nio/file/attribute/FileTime; +3 -1: lib +17 -1: getParameterTypes +15 -1: FinalizerThread +31 -1: ()Lsun/util/calendar/Gregorian; +50 -1: (Ljava/lang/CharSequence;)Ljava/lang/StringBuffer; +13 -1: PROP_SETTINGS +33 -1: java/util/function/BinaryOperator +70 -1: (ILjava/util/List;>;)Ljava/lang/invoke/MethodType; +25 -1: getDefaultRequestProperty +27 -1: (Ljava/util/jar/JarEntry;)V +27 -1: SPLITERATOR_CHARACTERISTICS +18 -1: FieldAccessor.java +10 -1: setComment +62 -1: (Ljava/lang/String;)Ljava/lang/management/MemoryManagerMXBean; +11 -1: array_klass +39 -1: ()Ljava/lang/Class$EnclosingMethodInfo; +67 -1: ([Ljava/lang/ClassValue$Entry<*>;ILjava/lang/ClassValue$Entry<*>;)I +9 -1: (II[CII)I +50 -1: (Ljava/util/jar/JarFile;Ljava/util/zip/ZipEntry;)V +20 -1: SPECIFICATION_VENDOR +72 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/net/URL;)Ljava/util/jar/JarFile; +87 -1: (Ljava/lang/ThreadLocal;>;TT;)V +9 -1: isVarArgs +10 -1: setBoolean +12 -1: (TK;TV;TV;)Z +16 -1: findSharedClass0 +5 -1: csize +49 -1: Ljava/security/cert/CertificateEncodingException; +40 -1: java/util/concurrent/locks/ReentrantLock +86 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/lang/String;)Lsun/nio/cs/StreamEncoder; +5 -1: ready +38 -1: Ljava/security/AccessControlException; +28 -1: UnmodifiableRandomAccessList +69 -1: ([TT;Ljava/util/function/BinaryOperator;)V +27 -1: Ljava/lang/invoke/Invokers; +39 -1: java/util/LinkedList$DescendingIterator +11 -1: writeFields +17 -1: classLoaderDepth0 +18 -1: permutedTypesMatch +52 -1: (Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/List; +12 -1: linkToStatic +10 -1: CheckedMap +6 -1: CENOFF +8 -1: lastRule +15 -1: java/lang/Short +39 -1: ()Ljava/lang/Class$ReflectionData; +8 -1: nextDown +14 -1: image/x-pixmap +39 -1: (Ljava/lang/Class;[Ljava/lang/Object;)V +25 -1: defineClassSourceLocation +23 -1: sun/misc/PostVMInitHook +15 -1: could not load +16 -1: allowArraySyntax +90 -1: Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater; +10 -1: putBoolean +11 -1: has params +14 -1: setMaxPriority +10 -1: mayContain +46 -1: java/lang/reflect/MalformedParametersException +10 -1: baseLocale +14 -1: isSubwordOrInt +10 -1: nextDouble +32 -1: java/lang/Character$UnicodeBlock +85 -1: (JLjava/util/function/ToDoubleBiFunction;DLjava/util/function/DoubleBinaryOperator;)D +20 -1: numberOfLeadingZeros +59 -1: (I[Ljava/lang/Class<*>;)[Ljava/lang/invoke/LambdaForm$Name; +7 -1: setSize +29 -1: java/io/FileNotFoundException +9 -1: getString +24 -1: ([CII)Ljava/lang/String; +38 -1: (Ljava/lang/String;Ljava/lang/Class;)V +5 -1: shift +18 -1: getConstructorSlot +41 -1: java/lang/ThreadLocal$SuppliedThreadLocal +16 -1: UNASSIGNED_STACK +20 -1: Malformed class name +12 -1: ofEpochMilli +34 -1: sun/launcher/LauncherHelper$StdArg +33 -1: java/nio/ByteBufferAsShortBufferB +7 -1: convert +21 -1: ()[Ljava/util/Locale; +15 -1: ISO_8859-5:1988 +35 -1: av[0] not instace of MethodHandle: +33 -1: java/nio/ByteBufferAsShortBufferL +5 -1: hypot +16 -1: InputStream.java +13 -1: reinvokerForm +39 -1: JVMTI_THREAD_STATE_WAITING_INDEFINITELY +16 -1: sun/misc/Version +66 -1: (Ljava/lang/Class;)[TT; +11 -1: codePointAt +30 -1: ([Ljava/lang/reflect/Method;)V +9 -1: duplicate +9 -1: interface +5 -1: X.509 +24 -1: SynchronizedNavigableSet +8 -1: us-ascii +17 -1: getUnresolvedType +21 -1: PRIVATE_USE_EXTENSION +4 -1: form +93 -1: (Ljava/util/ArrayPrefixHelpers$LongCumulateTask;Ljava/util/function/LongBinaryOperator;[JII)V +27 -1: sealing violation: package +34 -1: RuntimeVisibleParameterAnnotations +17 -1: LF_INVSTATIC_INIT +14 -1: Gregorian.java +32 -1: java/util/function/UnaryOperator +3 -1: log +3 -1: low +22 -1: sun/misc/JavaNetAccess +9 -1: getLength +21 -1: getRawTypeAnnotations +36 -1: (Ljava/lang/String;)Ljava/lang/Long; +9 -1: getNumber +66 -1: (ILjava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$Node; +20 -1: (Ljava/lang/Class;)C +89 -1: Ljava/lang/Object;Ljava/util/Map$Entry; +6 -1: ENDSIG +20 -1: (Ljava/lang/Class;)I +20 -1: (Ljava/lang/Class;)J +24 -1: [[Ljava/io/Serializable; +22 -1: serialPersistentFields +7 -1: console +142 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object; +27 -1: (Ljava/nio/ByteBuffer;ICZ)V +20 -1: (Ljava/lang/Class;)V +40 -1: java/lang/ArrayIndexOutOfBoundsException +6 -1: this$0 +51 -1: (Ljava/lang/invoke/MemberName;[Ljava/lang/Object;)V +18 -1: packageAccessValid +33 -1: ([Ljava/lang/StackTraceElement;)V +8 -1: constant +113 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;IILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class<*>; +8 -1: isMethod +20 -1: (Ljava/lang/Class;)Z +6 -1: ENDSIZ +8 -1: newEntry +57 -1: (Ljava/lang/Object;)Ljava/lang/IndexOutOfBoundsException; +25 -1: (Ljava/util/Comparator;)V +8 -1: isBridge +6 -1: ([BI)I +6 -1: ([BI)J +16 -1: getReferenceKind +26 -1: [Ljava/security/Principal; +71 -1: (Ljava/lang/Class;[Ljava/lang/reflect/Field;)[Ljava/lang/reflect/Field; +32 -1: ()Ljava/lang/ClassValue$Version; +16 -1: SearchValuesTask +17 -1: setCompressedSize +16 -1: DEFAULT_CAPACITY +108 -1: ;>()Ljava/util/Comparator;>; +27 -1: java/util/ComparableTimSort +41 -1: null StackTraceElement in serial stream. +6 -1: ([BI)V +44 -1: (Ljava/util/jar/JarFile;)Lsun/misc/JarIndex; +71 -1: (Ljava/util/jar/JarFile;Ljava/util/Enumeration;)Ljava/util/Enumeration; +52 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class<*>;)Z +36 -1: [Ljava/lang/reflect/TypeVariable<*>; +17 -1: OutputStream.java +8 -1: combiner +15 -1: decodeArrayLoop +19 -1: (Ljava/io/Writer;)V +41 -1: (Ljava/util/List<*>;Ljava/util/List<*>;)I +35 -1: ()[Ljava/security/cert/Certificate; +33 -1: ([I)Ljava/util/Spliterator$OfInt; +9 -1: NF_asType +17 -1: java/io/Closeable +11 -1: updateBytes +12 -1: charsets.jar +18 -1: getDeclaredFields0 +47 -1: (Ljava/lang/Object;I)Ljava/lang/reflect/Member; +60 -1: (Ljava/lang/String;ILjava/lang/String;)Ljava/nio/ByteBuffer; +15 -1: getTotalSeconds +57 -1: (Ljava/util/Collection<+Ljava/util/Map$Entry;>;)Z +4 -1: JULY +10 -1: Exceptions +41 -1: ()Ljava/util/List; +14 -1: ParseUtil.java +13 -1: getJarFileURL +29 -1: setJavaIOFileDescriptorAccess +24 -1: ARRAY_OBJECT_BASE_OFFSET +21 -1: onUnmappableCharacter +53 -1: (Ljava/lang/Object;Ljava/lang/Object;)Ljava/util/Map; +24 -1: MethodHandleNatives.java +40 -1: java/nio/charset/MalformedInputException +37 -1: [Ljava/lang/reflect/AnnotatedElement; +15 -1: CLASSPATH_CHARS +18 -1: [Ljava/lang/Class; +7 -1: FJFloat +47 -1: (Ljava/util/List;I)V +19 -1: Ljava/lang/Runtime; +23 -1: java/lang/CharacterData +42 -1: (Ljava/lang/Void;Ljava/lang/ClassLoader;)V +76 -1: (Ljava/nio/channels/ReadableByteChannel;Ljava/nio/charset/CharsetDecoder;I)V +56 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;B)V +19 -1: java/util/zip/CRC32 +33 -1: ([TT;I)[TT; +22 -1: ([F)Ljava/lang/String; +5 -1: UTF_8 +20 -1: aliases_UTF_32BE_BOM +11 -1: Buffer.java +78 -1: (Ljava/util/Comparator;)Ljava/util/Comparator; +44 -1: (Ljava/lang/String;)Ljava/util/zip/ZipEntry; +9 -1: malformed +4 -1: JUNE +51 -1: (Ljava/util/jar/JarFile;Ljava/util/jar/JarFile$1;)V +6 -1: locale +34 -1: (Ljava/util/function/BiFunction;)V +10 -1: setMinutes +40 -1: (Ljava/lang/reflect/AccessibleObject;Z)V +12 -1: maybeCompile +46 -1: (Ljava/lang/Class;Ljava/lang/reflect/Method;)V +7 -1: getEras +55 -1: ([TT;Ljava/util/Iterator<*>;)[TT; +17 -1: toUnsignedString0 +32 -1: (Ljava/lang/invoke/MethodType;)V +32 -1: (Ljava/lang/invoke/MethodType;)Z +10 -1: Class.java +27 -1: ()Ljava/util/Iterator; +29 -1: WINDOWS_EPOCH_IN_MICROSECONDS +41 -1: (Ljava/io/InputStream;)Ljava/lang/String; +4 -1: prev +24 -1: ()Ljava/util/Properties; +11 -1: awaitBooted +19 -1: generateConstructor +22 -1: sun/misc/SharedSecrets +19 -1: getDateTimeInstance +43 -1: (IIILsun/util/calendar/BaseCalendar$Date;)J +5 -1: setID +11 -1: Locale.java +12 -1: getRootGroup +15 -1: setLastModified +7 -1: trouble +28 -1: (Z)Ljava/lang/StringBuilder; +5 -1: setIO +17 -1: loadClassInternal +23 -1: java/lang/ref/Finalizer +8 -1: EmptySet +16 -1: aliases_UTF_16BE +50 -1: (Ljava/util/NavigableMap;)Ljava/util/NavigableMap; +15 -1: unmodifiableMap +48 -1: (Ljava/lang/Class<*>;)Lsun/reflect/ConstantPool; +15 -1: arrayContentsEq +7 -1: EXT_TAG +31 -1: (Ljava/util/HashMap$TreeNode;)Z +5 -1: cp737 +22 -1: java/util/zip/Checksum +5 -1: names +22 -1: ConcurrentHashMap.java +7 -1: ([J[J)Z +7 -1: WAITING +31 -1: sun.launcher.resources.launcher +14 -1: getThreadGroup +8 -1: PutField +12 -1: hugeCapacity +9 -1: isPackage +72 -1: (Ljava/lang/ThreadLocal<*>;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry; +23 7: sun/nio/ch/DirectBuffer +13 -1: Checksum.java +25 -1: (Ljava/nio/ByteBuffer;I)C +51 -1: (Ljava/lang/invoke/MethodHandle;)Ljava/lang/Object; +25 -1: (Ljava/nio/ByteBuffer;I)D +7 -1: treeify +25 -1: (Ljava/nio/ByteBuffer;I)F +5 -1: setIn +25 -1: (Ljava/nio/ByteBuffer;I)I +20 -1: TRACE_METHOD_LINKAGE +25 -1: (Ljava/nio/ByteBuffer;I)J +7 -1: putIntB +22 -1: createGarbageCollector +50 -1: (Ljava/lang/Class;)[TT; +25 -1: (Ljava/nio/ByteBuffer;I)S +7 -1: putIntL +19 -1: (B)Ljava/lang/Byte; +14 -1: Hashtable.java +29 -1: java/lang/ArrayStoreException +11 -1: all_allowed +16 -1: getLastRawOffset +7 -1: inReady +36 -1: java/lang/ThreadLocal$ThreadLocalMap +40 -1: (ILjava/lang/String;Ljava/lang/String;)V +23 -1: Ljava/lang/ThreadLocal; +16 -1: classValueOrNull +62 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/MethodHandle; +23 -1: preparedFieldLambdaForm +22 -1: (Z)Ljava/lang/Boolean; +14 -1: ThreadLocalMap +27 -1: java/lang/StackTraceElement +13 -1: getEntryCSize +19 -1: java.security.debug +53 -1: (Ljava/util/Collection<*>;Ljava/util/Collection<*>;)Z +6 -1: LOCLEN +40 -1: Ljava/lang/Class; +6 -1: (JJB)V +66 -1: Ljava/util/Hashtable; +31 -1: [[Ljava/lang/StackTraceElement; +9 -1: putStatic +16 -1: Asia/Ho_Chi_Minh +15 -1: getDisplayNames +13 -1: convertToAbbr +23 -1: Method not implemented. +15 -1: isCCLOverridden +14 -1: doubleCapacity +137 -1: (Ljava/lang/Class<*>;ZLjava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Class<*>;)Ljava/util/List; +219 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysTask;Ljava/util/function/Function;Ljava/util/function/BiFunction;)V +7 -1: native +29 -1: (Ljava/lang/reflect/Field;Z)V +18 -1: Ljava/util/Locale; +31 -1: Ljava/util/concurrent/TimeUnit; +16 -1: threadsSuspended +7 -1: ([III)V +20 -1: setMaxDelimCodePoint +18 -1: contentClassPrefix +13 -1: mappingOffset +10 -1: toIndex = +47 -1: (Ljava/lang/CharSequence;)Ljava/io/PrintStream; +12 -1: booleanValue +13 -1: putMapEntries +17 -1: defaultBundleName +50 -1: (Ljava/util/concurrent/CountedCompleter;[B[BIIII)V +10 -1: executable +20 -1: java/time/ZoneOffset +28 -1: java/lang/ref/FinalReference +11 -1: newTreeNode +7 -1: lookup2 +10 -1: TableStack +59 -1: Ljava/util/concurrent/ConcurrentHashMap$ValuesView; +11 -1: getAccessor +9 -1: available +18 -1: java/io/FileReader +34 -1: java/security/ProtectionDomain$3$1 +16 -1: integer overflow +11 -1: internTable +28 -1: Ljava/util/HashMap$TreeNode; +19 -1: | invocationCounter +12 -1: findResource +9 -1: isLoaded0 +5 -1: cp775 +24 -1: DIRECTIONALITY_UNDEFINED +9 -1: isInvalid +7 -1: lookupN +35 -1: (Lsun/reflect/MethodAccessorImpl;)V +6 -1: ENDSUB +4 -1: to +59 -1: ([Ljava/lang/Object;IILjava/lang/Class;)[Ljava/lang/Object; +10 -1: meta-index +6 -1: INDENT +9 -1: WEDNESDAY +40 -1: ()Ljava/lang/annotation/RetentionPolicy; +14 -1: getUsableSpace +7 -1: TUESDAY +51 -1: (Ljava/lang/Class;I)Ljava/lang/invoke/MethodHandle; +12 -1: getSubjectDN +21 -1: Ljava/io/InputStream; +25 -1: (IC)Ljava/nio/CharBuffer; +52 -1: (Ljava/nio/CharBuffer;)Ljava/util/function/Supplier; +17 -1: ()[Ljava/net/URL; +6 -1: search +10 -1: Main-Class +8 -1: ([CIIC)I +16 -1: Certificate.java +14 -1: spreadInvokers +22 -1: sun/nio/cs/ISO_8859_15 +6 -1: accept +18 -1: ReflectAccess.java +13 -1: java/nio/Bits +14 -1: linkToCallSite +46 -1: Ljava/nio/charset/UnsupportedCharsetException; +8 -1: ([CIIC)V +9 -1: (TT;TV;)V +26 -1: java/lang/OutOfMemoryError +34 -1: policy loading and granting +76 -1: (Ljava/nio/CharBuffer;ILjava/nio/ByteBuffer;I)Ljava/nio/charset/CoderResult; +13 -1: x-windows-949 +21 -1: Ljava/io/PrintStream; +9 -1: initNames +12 -1: testAnyFlags +65 -1: (Ljava/lang/reflect/Method;)Ljava/lang/invoke/DirectMethodHandle; +34 -1: (Ljava/util/List;)Ljava/util/List; +10 -1: CacheEntry +10 -1: hasAllPerm +26 -1: java/nio/charset/Charset$1 +26 -1: java/nio/charset/Charset$2 +19 -1: ()Ljava/util/Stack; +26 -1: java/nio/charset/Charset$3 +62 -1: (Ljava/lang/String;)Lsun/util/calendar/LocalGregorianCalendar; +23 -1: ARRAY_FLOAT_INDEX_SCALE +23 -1: (Ljava/lang/Object;IS)V +13 -1: x-windows-950 +31 -1: Ljava/util/Hashtable$Entry<**>; +87 -1: Ljava/util/WeakHashMap;>; +9 -1: permClass +37 -1: (Ljava/security/ProtectionDomain$3;)V +99 -1: Lsun/reflect/generics/repository/AbstractRepository; +37 -1: ()Ljava/util/function/BinaryOperator; +64 -1: java/util/Collections$UnmodifiableNavigableMap$EmptyNavigableMap +91 -1: (Ljava/util/ArrayPrefixHelpers$IntCumulateTask;Ljava/util/function/IntBinaryOperator;[III)V +6 -1: getCrc +25 -1: ByteArrayInputStream.java +9 -1: SYNTHETIC +52 -1: Ljava/lang/ref/PhantomReference; +246 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysToDoubleTask;Ljava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)V +38 -1: java/lang/Throwable$WrappedPrintStream +21 -1: Illegal load factor: +43 -1: Ljava/util/Deque; +3 -1: map +6 -1: expand +6 -1: access +3 -1: max +33 -1: impliesCreateAccessControlContext +3 -1: may +53 -1: java/util/concurrent/ConcurrentHashMap$ReduceKeysTask +91 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction; +60 -1: attempt to add a Permission to a readonly Permissions object +21 -1: canonicalizeExtension +11 -1: copyValueOf +25 -1: (IJ)Ljava/nio/LongBuffer; +112 -1: (JLjava/util/function/Function<-TV;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU; +11 -1: DeqIterator +11 -1: SpeciesData +8 -1: getCause +16 -1: aliases_UTF_16LE +51 -1: (TT;TV;Ljava/util/function/BinaryOperator;)TV; +25 -1: (JF)Ljava/nio/ByteBuffer; +16 -1: sun/misc/IOUtils +32 -1: Ljava/util/Locale$FilteringMode; +6 -1: .class +13 -1: getPermission +13 -1: startsWithLOC +8 -1: Identity +23 -1: ([BII)Ljava/lang/Class; +15 -1: putByteVolatile +36 -1: (Ljava/util/Deque;)Ljava/util/Queue; +22 -1: (Ljava/lang/Object;S)V +47 -1: java/util/concurrent/ConcurrentHashMap$BulkTask +4 -1: n = +9 -1: (ITE;)TE; +5 -1: zeroD +18 -1: formatUnsignedLong +29 -1: default display locale = +23 -1: java/io/File$PathStatus +5 -1: zeroF +20 -1: Ljava/util/Set; +20 -1: (Ljava/util/List;I)V +5 -1: zeroI +5 -1: zeroJ +7 -1: context +39 -1: Ljava/nio/channels/WritableByteChannel; +5 -1: zeroL +34 -1: Lsun/util/calendar/CalendarSystem; +24 -1: JVMTI_THREAD_STATE_ALIVE +18 -1: (Ljava/util/Set;)V +18 -1: (Ljava/util/Set;)Z +42 -1: (TT;Ljava/lang/ref/ReferenceQueue<-TT;>;)V +7 -1: entries +30 -1: (Ljava/util/WeakHashMap;IIII)V +15 -1: csisolatingreek +38 -1: ([Ljava/lang/Class;)Ljava/lang/Object; +12 -1: isMalformed3 +12 -1: isMalformed4 +5 -1: FJInt +23 -1: java/util/LinkedHashMap +20 -1: malformedInputAction +12 -1: Charset.java +5 -1: LLL_L +42 -1: (Ljava/util/Collection;)Ljava/lang/Object; +22 -1: makeMethodHandleInvoke +3 -1: mdt +7 -1: unicode +12 -1: newInstance0 +10 -1: checkCerts +34 -1: java/util/WeakHashMap$HashIterator +23 -1: (Ljava/lang/Object;JI)I +9 -1: hexDigits +13 -1: javaToDosTime +24 -1: (I)Ljava/nio/LongBuffer; +6 -1: A_DATA +12 -1: deepToString +23 -1: (Ljava/lang/Object;JI)V +91 -1: (JLjava/util/function/ToLongBiFunction<-TK;-TV;>;JLjava/util/function/LongBinaryOperator;)J +23 -1: bad spread array length +11 -1: readTimeout +14 -1: toAbsolutePath +8 -1: isFinite +19 -1: currentLoadedClass0 +3 -1: \xef\xbf\xbd +23 -1: (Ljava/nio/file/Path;)I +8 -1: handlers +21 -1: (Ljava/util/List;II)V +89 -1: (Lsun/misc/URLClassPath$Loader;Ljava/lang/String;Ljava/net/URL;Ljava/net/URLConnection;)V +8 -1: OVERFLOW +8 -1: newTable +8 -1: THURSDAY +6 -1: notify +12 -1: initialValue +35 -1: (I)Ljava/util/LinkedList$Node; +18 -1: AsVarargsCollector +26 -1: (Lsun/misc/JavaIOAccess;)V +18 -1: ()Ljava/lang/Void; +23 -1: (Ljava/nio/file/Path;)Z +16 -1: MINUTE_IN_MILLIS +67 -1: (Ljava/lang/Class;[Ljava/lang/Class;Z)Ljava/lang/invoke/MethodType; +18 -1: Ljava/util/Vector; +70 -1: (Ljava/lang/reflect/Constructor;[Ljava/lang/Object;)Ljava/lang/Object; +40 -1: (Ljava/lang/Object;ILjava/lang/Object;)V +25 -1: UnresolvedPermission.java +14 -1: ReduceKeysTask +21 -1: ()[Ljava/lang/Object; +129 -1: Ljava/lang/Object;Ljava/util/Collection;Ljava/io/Serializable; +16 -1: ClassLoader.java +46 -1: Ljava/util/Comparators$NaturalOrderComparator; +17 -1: compareAndSwapInt +22 -1: packageDefinitionValid +41 -1: ([Ljava/lang/Object;[Ljava/lang/Object;)Z +162 -1: (Ljava/util/List;Ljava/util/Collection;Ljava/util/Locale$FilteringMode;)Ljava/util/List; +16 -1: sun.zip.zipFiles +17 -1: java_runtime_name +31 -1: (Ljava/lang/ClassValue$Entry;)V +31 -1: (Ljava/lang/ClassValue$Entry;)Z +30 -1: (TT;)TT; +39 -1: JavaSecurityProtectionDomainAccess.java +24 -1: (I)Ljava/lang/Throwable; +7 -1: FJShort +9 -1: putFloatB +19 -1: checkedNavigableSet +25 -1: java/lang/invoke/Invokers +18 -1: setIfModifiedSince +14 -1: parameterTypes +41 -1: (Ljava/lang/Object;Ljava/lang/Runnable;)V +9 -1: putFloatL +11 -1: getTypeCode +5 -1: (ZZ)I +24 -1: java/lang/ProcessBuilder +9 -1: UNDERFLOW +21 -1: VolatileCallSite.java +24 -1: (C)Ljava/nio/CharBuffer; +55 -1: java/util/concurrent/ConcurrentHashMap$ForEachValueTask +26 -1: (Ljava/lang/String;[CII)[B +18 -1: reduceKeysToDouble +5 -1: (ZZ)Z +23 -1: setCallSiteTargetNormal +3 -1: min +4 -1: ceil +62 -1: (Ljava/lang/String;)Ljava/util/LinkedList; +29 -1: (Ljava/util/AbstractList;II)V +32 -1: Ljava/lang/Class$AnnotationData; +21 -1: createFileExclusively +64 -1: (Ljava/lang/ref/SoftReference;I)Ljava/lang/Class$ReflectionData; +26 -1: java/lang/Short$ShortCache +54 -1: (Ljava/net/URL;Ljava/io/File;)Ljava/net/URLConnection; +29 -1: Lsun/nio/cs/Surrogate$Parser; +58 -1: (Ljava/lang/Class;)Lsun/reflect/annotation/AnnotationType; +8 -1: findForm +53 -1: Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet; +39 -1: (Lsun/misc/Perf;Ljava/nio/ByteBuffer;)V +16 -1: mergePermissions +11 -1: totalMemory +53 -1: java/lang/invoke/DirectMethodHandle$EnsureInitialized +139 -1: Ljava/util/AbstractMap;Ljava/util/concurrent/ConcurrentMap;Ljava/io/Serializable; +29 -1: java/util/HashMap$KeyIterator +20 -1: STACK_TRACE_SENTINEL +5 -1: order +18 -1: java/lang/Runnable +8 -1: GetField +13 -1: Empty command +7 -1: CONTROL +9 -1: blockedOn +12 -1: testAllFlags +11 -1: getInflater +16 -1: threadTerminated +44 -1: (Ljava/lang/ThreadGroup;Ljava/lang/String;)V +20 -1: java.runtime.version +8 -1: peekLast +23 -1: java/util/ArrayList$Itr +21 -1: (Ljava/util/Locale;)V +13 -1: isOptimizable +8 -1: FairSync +7 -1: CHINESE +15 -1: initHelpMessage +30 -1: ()Ljava/util/HashMap$TreeNode; +29 -1: Ljava/lang/SecurityException; +7 -1: charset +35 -1: sun/security/util/SecurityConstants +19 -1: sun.nio.cs.bugLevel +8 2: Foo.java +49 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;)V +12 -1: EntrySetView +37 -1: (Lsun/misc/JavaNetHttpCookieAccess;)V +35 -1: Ljava/util/Hashtable$Entry; +20 -1: NF_constructorMethod +8 -1: getMonth +38 -1: (Ljava/util/Iterator;Ljava/util/Map;)V +14 -1: getIntVolatile +6 -1: [name= +8 -1: oop_size +20 -1: Can't load library: +30 -1: ()Ljava/util/Spliterator; +33 -1: Lsun/reflect/ConstructorAccessor; +61 -1: Ljava/lang/Number;Ljava/lang/Comparable; +15 -1: printVmSettings +33 -1: stack include stack trace +45 -1: ([Ljava/lang/Object;I)Ljava/util/Spliterator; +37 -1: sun/reflect/generics/scope/ClassScope +36 -1: java/io/UnsupportedEncodingException +24 -1: (J)Ljava/nio/LongBuffer; +11 -1: addressSize +15 -1: ByteBuffer.java +62 -1: (Ljava/lang/String;)Lsun/reflect/generics/tree/ClassSignature; +9 -1: (TT;TT;)I +25 -1: java/io/DefaultFileSystem +15 -1: BaseLocale.java +14 -1: BitSetIterator +17 -1: AbstractList.java +57 -1: Ljava/lang/ref/WeakReference;>; +178 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object; +9 -1: arguments +26 -1: java/util/Locale$LocaleKey +9 -1: setLength +29 -1: sun/nio/cs/ISO_8859_1$Decoder +9 -1: zipfs.jar +24 -1: Ljava/util/zip/ZipCoder; +14 -1: , new state = +93 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;IIIJLjava/util/concurrent/ConcurrentHashMap;)V +39 -1: java/security/PrivilegedExceptionAction +9 -1: dnsns.jar +20 -1: iteratorBinarySearch +14 -1: initializePath +22 -1: DefaultFileSystem.java +17 -1: Ljava/util/Deque; +8 -1: DEFLATED +11 -1: Can't load +9 -1: ArrayList +21 -1: negativeZeroFloatBits +41 -1: (Ljava/lang/String;ILjava/util/Locale;)[C +14 -1: ANSI_X3.4-1968 +39 -1: sun/reflect/annotation/AnnotationType$1 +3 -1: mod +62 -1: Ljava/nio/Buffer;Ljava/lang/Comparable; +29 -1: interpretWithArgumentsTracing +6 -1: getDay +47 -1: sun/reflect/generics/repository/ClassRepository +19 -1: refKindDoesDispatch +20 -1: getAnnotationsByType +14 -1: needsExpansion +18 -1: lastIndexOfSubList +26 -1: JavaUtilZipFileAccess.java +59 -1: (Ljava/lang/CharSequence;)Ljava/lang/AbstractStringBuilder; +12 -1: ptypesOffset +8 -1: hashcode +18 -1: ([Ljava/net/URL;)V +8 -1: iso-ir-6 +7 -1: jzentry +52 -1: only dump output if specified codebase +31 -1: lambda$comparingLong$6043328a$1 +5 -1: MARCH +14 -1: ANSI_X3.4-1986 +14 -1: isMalformed3_2 +7 -1: IS_TYPE +68 -1: Ljava/lang/Object;Ljava/lang/Comparable; +30 -1: protocol doesn't support input +17 -1: getExtClassLoader +14 -1: setProxiedHost +73 -1: ()Ljava/util/Map;>; +16 -1: traceInterpreter +17 -1: (Ljava/net/URL;)I +5 -1: expm1 +18 -1: createInheritedMap +66 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedEntryTask +17 -1: getTimeOfDayValue +15 -1: zeroLengthArray +20 -1: invalid permission: +6 -1: REPORT +15 -1: isNumericString +78 -1: (Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/util/Formatter; +6 -1: (TV;)Z +25 -1: Lsun/misc/JavaLangAccess; +29 -1: (I)Ljava/lang/reflect/Method; +17 -1: (Ljava/net/URL;)V +34 -1: ()Ljava/lang/Class$ReflectionData; +50 -1: java.lang.invoke.MethodHandle.TRACE_METHOD_LINKAGE +10 -1: copyWith: +17 -1: (Ljava/net/URL;)Z +32 -1: ()Ljava/util/stream/Stream; +22 -1: quickCheckMemberAccess +29 -1: ()Lsun/net/www/MessageHeader; +19 -1: getAssignedCombiner +8 -1: ([JIIJ)I +17 -1: formatUnsignedInt +68 -1: Ljava/util/AbstractMap; +34 -1: java/nio/ByteBufferAsDoubleBufferB +32 -1: ([I)Ljava/util/stream/IntStream; +9 -1: init_lock +18 -1: must be resolved: +42 -1: ()Ljava/nio/channels/spi/SelectorProvider; +8 -1: ([JIIJ)V +33 -1: IncompatibleClassChangeError.java +34 -1: java/nio/ByteBufferAsDoubleBufferL +31 -1: ()Ljava/util/function/Function; +43 -1: Ljava/lang/Enum; +17 -1: availableCharsets +49 -1: java/util/ArraysParallelSortHelpers$FJChar$Sorter +22 -1: permission= +22 -1: getAnnotatedSuperclass +20 -1: isObjectPublicMethod +15 -1: Attempt to get +10 -1: createLong +14 -1: HASH_INCREMENT +32 -1: sun/management/ManagementFactory +13 -1: separatorChar +15 -1: bad field type +8 -1: november +27 -1: (F)Ljava/lang/StringBuffer; +3 -1: EAT +3 -1: mst +54 -1: (Ljava/lang/reflect/Method;)Ljava/lang/reflect/Method; +18 -1: Ljava/lang/Object; +7 -1: ;:&=+$, +12 -1: Handler.java +7 -1: isDirty +127 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;[Ljava/security/Permission;)TT; +14 -1: asTypeUncached +5 -1: split +200 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/reflect/AnnotatedElement;Ljava/lang/Class;Ljava/lang/reflect/Type;Lsun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget;)Ljava/lang/reflect/AnnotatedType; +47 -1: java.lang.invoke.MethodHandle.TRACE_INTERPRETER +22 -1: sun/invoke/empty/Empty +66 -1: (Ljava/util/Map;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/Map; +18 -1: jvm_update_version +32 -1: (Ljava/util/Map;)Ljava/util/Map; +14 -1: cacheLoadLimit +8 -1: javaHome +52 -1: (Ljava/lang/reflect/Field;)Ljava/lang/reflect/Field; +20 -1: [[Ljava/lang/Object; +19 -1: isJavaLetterOrDigit +11 -1: loadLibrary +32 -1: java/io/StreamCorruptedException +14 -1: setAccessible0 +27 -1: sun/nio/cs/UTF_16LE$Encoder +60 -1: (Ljava/lang/String;[Ljava/lang/Object;)Ljava/io/PrintStream; +8 -1: segments +10 -1: UTF_8.java +3 -1: ECT +5 -1: cp813 +5 -1: cp819 +61 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/Comparator;)I +5 -1: Cache +4 -1: sinh +32 -1: java/util/function/ToIntFunction +10 -1: setFactory +24 -1: Illegal mappings count: +16 -1: fileToEncodedURL +38 -1: Ljava/lang/annotation/RetentionPolicy; +27 -1: Ljava/net/SocketPermission; +46 -1: (Ljava/lang/CharSequence;I)[Ljava/lang/String; +11 -1: cardinality +13 -1: getMonthValue +64 -1: (Ljava/lang/invoke/MethodType;II)Ljava/lang/invoke/MethodHandle; +6 -1: ENDTOT +12 -1: getBytesUTF8 +9 -1: cacheLoad +13 -1: packageAccess +14 -1: sharedToString +5 -1: merge +29 -1: parameter type cannot be void +27 -1: makePreparedFieldLambdaForm +40 -1: Couldn't find 3-letter country code for +166 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/net/URL;Ljava/lang/ClassLoader;)V +19 -1: (Ljava/util/Map;Z)V +13 -1: setExecutable +17 -1: objectFieldOffset +57 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V +128 -1: (Ljava/lang/Class<*>;ZLjava/lang/String;Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Ljava/util/List; +61 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysToIntTask +6 -1: asType +25 -1: java/io/ObjectStreamField +15 -1: jvmMajorVersion +124 -1: (Ljava/security/PrivilegedExceptionAction;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/lang/Object; +23 -1: (Ljava/lang/Class<*>;)C +6 -1: andNot +15 -1: getResponseCode +59 -1: (Ljava/lang/StringBuffer;)Ljava/lang/AbstractStringBuilder; +23 -1: (Ljava/lang/Class<*>;)I +7 -1: seeAllp +44 -1: (Ljava/lang/ClassLoader;[Ljava/lang/Class;)V +13 -1: loadFromCache +35 -1: sun/nio/cs/HistoricallyNamedCharset +38 -1: (Ljava/lang/Class;[Ljava/lang/Class;)V +19 -1: INVOKER_METHOD_TYPE +16 -1: putShortVolatile +12 -1: Asia/Karachi +8 -1: cyrillic +12 -1: getISO2Table +23 -1: (Ljava/lang/Class<*>;)V +3 -1: 1.4 +15 -1: LongBuffer.java +6 -1: (IFZ)V +23 -1: (Ljava/lang/Class<*>;)Z +10 -1: initOutput +9 -1: CELLSBUSY +39 -1: java/security/PrivilegedActionException +31 -1: sun/util/calendar/CalendarUtils +202 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/reflect/AnnotatedElement;Ljava/lang/Class;[Ljava/lang/reflect/Type;Lsun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget;)[Ljava/lang/reflect/AnnotatedType; +20 -1: Ljava/lang/Class<*>; +5 -1: cp850 +25 -1: (JI)Ljava/nio/ByteBuffer; +5 -1: cp852 +24 -1: Invalid parameter name " +39 -1: ([CII)Ljava/lang/AbstractStringBuilder; +5 -1: cp855 +11 -1: Deallocator +5 -1: cp857 +5 -1: cp858 +7 -1: ([SI)[S +37 -1: ([C)Ljava/lang/AbstractStringBuilder; +27 -1: java/lang/SecurityException +82 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;Ljava/lang/invoke/MethodHandle;)V +38 -1: (Ljava/lang/String;)Ljava/lang/String; +7 -1: connect +7 -1: isEmpty +11 -1: replaceNode +19 -1: SuppliedThreadLocal +12 -1: asFixedArity +12 -1: fromIndex = +19 -1: createMemoryManager +9 -1: List.java +8 -1: FEBRUARY +21 -1: UnicodeLittleUnmarked +6 -1: a null +30 -1: ()Ljava/util/Spliterator; +5 -1: cp862 +17 -1: ZoneInfoFile.java +5 -1: cp866 +8 -1: BulkTask +53 -1: java/util/concurrent/locks/AbstractQueuedSynchronizer +20 -1: FileInputStream.java +12 -1: java.vm.info +10 -1: newDecoder +5 -1: (JB)V +8 -1: filePath +17 -1: spreadArrayChecks +44 -1: ([Ljava/lang/Object;Ljava/util/Comparator;)V +33 -1: java/util/Collections$AsLIFOQueue +32 -1: Ljava/util/LinkedList$Node; +5 -1: cp874 +78 -1: (Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/io/PrintStream; +39 -1: (JLjava/util/function/Consumer<-TK;>;)V +15 -1: appendCodePoint +20 -1: primitiveReturnCount +54 -1: only dump output if specified permission +20 -1: getGenericInterfaces +41 -1: ([Ljava/lang/reflect/AccessibleObject;Z)V +17 -1: nUnstartedThreads +33 -1: (Ljava/lang/invoke/MemberName;Z)V +24 -1: ARRAY_OBJECT_INDEX_SCALE +40 -1: (Ljava/lang/String;ILjava/util/Locale;)I +17 -1: java/io/Flushable +22 -1: newConstructorAccessor +26 -1: sun/misc/JavaUtilJarAccess +6 -1: booted +10 -1: setDoInput +36 -1: (Ljava/lang/Class;)[Ljava/lang/Enum; +19 -1: java/lang/Character +52 -1: ([Ljava/net/URL;Ljava/net/URLStreamHandlerFactory;)V +24 -1: (Ljava/nio/LongBuffer;)I +16 -1: start > length() +28 -1: (I)Ljava/lang/CharacterData; +5 -1: val$c +61 -1: (Ljava/lang/Throwable;Ljava/lang/String;[Ljava/lang/Object;)V +13 -1: resolveOrNull +9 -1: L_ESCAPED +27 -1: MapReduceValuesToDoubleTask +15 -1: getPreparedForm +33 -1: (I)[Ljava/util/WeakHashMap$Entry; +54 -1: ()Ljava/util/stream/Stream<+Ljava/util/zip/ZipEntry;>; +16 -1: bad method type +5 -1: val$s +17 -1: Null charset name +36 -1: java/lang/invoke/LambdaForm$Compiled +24 -1: (Ljava/util/SortedMap;)V +19 -1: java/time/LocalTime +29 -1: not invocable, no method type +21 -1: recalculateWordsInUse +6 -1: val$id +39 -1: sun/security/util/ManifestEntryVerifier +60 -1: ([Ljava/lang/Class<*>;I)Ljava/lang/reflect/Constructor; +45 -1: java/util/ArrayPrefixHelpers$LongCumulateTask +5 -1: OfInt +11 -1: environment +60 -1: ([Ljava/lang/Class<*>;[B)[[Ljava/lang/annotation/Annotation; +7 -1: (JJJZ)V +10 -1: BufferPool +6 -1: isUTF8 +12 -1: threadLocals +35 -1: (Ljava/lang/String;)[Ljava/net/URL; +21 -1: Ljava/nio/LongBuffer; +15 -1: copyConstructor +25 -1: setCallSiteTargetVolatile +15 -1: getNumericValue +26 -1: Ljava/security/CodeSource; +18 -1: Null output stream +14 -1: cloneWithIndex +23 -1: LOCAL_LISTEN_PERMISSION +6 -1: (TT;)I +46 -1: (Ljava/security/PublicKey;Ljava/lang/String;)V +6 -1: setCrc +26 -1: java/io/FilterOutputStream +10 -1: access$000 +10 -1: access$001 +10 -1: access$002 +6 -1: (TT;)V +78 -1: ([TU;IILjava/lang/Class<+[TT;>;)[TT; +41 -1: java/util/concurrent/atomic/AtomicInteger +8 -1: renameTo +40 -1: (Ljava/lang/Class<*>;)Ljava/lang/Object; +17 -1: getRawAnnotations +29 -1: java/lang/VirtualMachineError +37 -1: java/lang/management/MemoryPoolMXBean +25 -1: (II)Ljava/util/List; +6 -1: utf_16 +23 -1: (Ljava/lang/String;[B)V +19 -1: MIN_ARRAY_SORT_GRAN +25 -1: array length is not legal +45 -1: java/util/concurrent/locks/ReentrantLock$Sync +36 -1: Ljava/security/AccessControlContext; +48 -1: sun/reflect/generics/repository/MethodRepository +24 -1: MethodHandleStatics.java +24 -1: addThreadDumpForMonitors +64 -1: (Ljava/util/Set;)Ljava/util/Set; +58 -1: (Ljava/lang/String;[Ljava/lang/Object;Ljava/lang/Object;)Z +37 -1: (III)Lsun/util/calendar/CalendarDate; +9 -1: createURI +15 -1: unreserveMemory +52 -1: (Lsun/reflect/MethodInfo;)Ljava/lang/reflect/Method; +66 -1: (Ljava/lang/Class;[Ljava/lang/Class;)Ljava/lang/invoke/MethodType; +51 -1: (Ljava/lang/reflect/Constructor;)Ljava/lang/String; +23 -1: inheritableThreadLocals +63 -1: ()Ljava/util/Map; +16 -1: setContentLength +16 -1: LOWERCASE_LETTER +4 -1: size +25 -1: java.launcher.opt.hotspot +19 -1: buildAnnotatedTypes +26 -1: JAVAFX_LAUNCHER_CLASS_NAME +11 -1: getAliasMap +19 -1: CheckedNavigableSet +15 -1: getAbsolutePath +11 -1: doubleValue +6 -1: utf_32 +22 -1: IMPLEMENTATION_VERSION +3 -1: ne1 +11 -1: contentType +8 -1: canWrite +11 -1: Object.java +14 -1: America/Denver +8 -1: fileName +13 -1: allPermDomain +27 -1: ()Ljava/util/Iterator; +31 -1: (Lsun/reflect/MethodAccessor;)V +11 -1: asTypeCache +13 -1: lineSeparator +9 -1: JarLoader +15 -1: replacementNode +18 -1: getContentEncoding +12 -1: invoke_LLL_L +22 -1: ()Ljava/util/TimeZone; +17 -1: Reference Handler +33 -1: java/lang/invoke/MethodHandleImpl +47 -1: ()Ljava/util/concurrent/ConcurrentHashMap$Node; +12 -1: invoke_LLL_V +8 -1: form << +23 -1: (Ljava/lang/Object;JJ)J +15 -1: isHighSurrogate +31 -1: (Ljava/util/Collection<+TV;>;)Z +36 -1: ([Ljava/util/HashMap$Node;)V +23 -1: (Ljava/lang/Object;JJ)V +12 -1: utf_32be_bom +40 -1: sun/util/calendar/LocalGregorianCalendar +27 -1: [Ljava/security/CodeSigner; +15 -1: afterNodeAccess +13 -1: nextThreadNum +18 -1: INTERNED_ARGUMENTS +11 -1: getMillisOf +18 -1: offsetByCodePoints +11 -1: writeObject +48 -1: (Ljava/util/Locale$Category;Ljava/util/Locale;)V +3 -1: nfe +41 -1: (Ljava/util/Properties;Ljava/io/Reader;)V +50 -1: (Ljava/util/concurrent/CountedCompleter;[C[CIIII)V +15 -1: implFlushBuffer +33 -1: (I)[Ljava/lang/invoke/MemberName; +12 -1: Unicode.java +17 -1: DMH.invokeVirtual +5 -1: setup +51 -1: (Ljava/util/Collection;[Ljava/lang/reflect/Field;)V +3 -1: EST +7 -1: TREEBIN +7 -1: getFile +10 -1: isLeapYear +18 -1: LinkedHashIterator +14 -1: DISPLAY_SCRIPT +25 -1: privateGetDeclaredMethods +68 -1: (Ljava/util/function/Function;Ljava/lang/Object;Ljava/lang/Object;)I +22 -1: ()Ljava/util/Iterator; +21 -1: sun/management/Sensor +15 -1: getAvailableIDs +51 -1: Lsun/util/PreHashedMap; +8 -1: elot_928 +6 -1: LATIN0 +45 -1: ([Ljava/lang/Object;II[Ljava/lang/Object;II)V +10 -1: [Unlocked] +15 -1: internArguments +6 -1: LATIN9 +33 -1: (II)Ljava/lang/invoke/MethodType; +12 -1: Version.java +17 -1: setConnectTimeout +75 -1: (Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/lang/String; +13 -1: highSurrogate +12 -1: Africa/Cairo +21 -1: synchronizedSortedMap +21 -1: in java.library.path +45 -1: sun/reflect/generics/tree/FormalTypeParameter +24 -1: UncaughtExceptionHandler +14 -1: previousOrSame +24 -1: java/security/Permission +9 -1: x-ISCII91 +5 -1: L_HEX +35 -1: java/lang/invoke/DirectMethodHandle +35 -1: java/util/ArrayDeque$DeqSpliterator +14 -1: java/util/List +11 -1: toLowerCase +24 -1: java/nio/charset/Charset +10 -1: MIN_NORMAL +110 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object; +13 -1: regionMatches +17 -1: newMethodAccessor +26 -1: (Ljava/net/InetAddress;B)V +68 -1: (Ljava/util/zip/ZipFile;Ljava/lang/String;J)Ljava/util/zip/ZipEntry; +22 -1: ()Ljava/io/FileSystem; +19 -1: primitiveSimpleName +5 -1: MOVED +9 -1: STATE_RED +13 -1: linkToSpecial +19 -1: AnnotationType.java +20 -1: (II)Ljava/util/List; +252 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsToDoubleTask;Ljava/util/function/ToDoubleBiFunction;DLjava/util/function/DoubleBinaryOperator;)V +12 -1: callSiteForm +22 -1: isSiblingBindingBefore +62 -1: ([TT;IITT;Ljava/util/Comparator<-TT;>;)I +15 -1: buildEmptyNames +11 -1: Thread.java +30 -1: Ljava/lang/ref/Reference; +35 -1: sun/reflect/MethodAccessorGenerator +152 -1: (Ljava/util/function/Function;Ljava/util/function/Function;Ljava/util/function/BinaryOperator;Ljava/util/function/Supplier;)Ljava/util/stream/Collector; +5 -1: total +242 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesToLongTask;Ljava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)V +27 -1: javax/security/auth/Subject +43 -1: JVMTI_THREAD_STATE_BLOCKED_ON_MONITOR_ENTER +17 -1: getSignerCertPath +15 -1: registerNatives +21 -1: sun/reflect/FieldInfo +54 -1: (Ljava/nio/charset/Charset;Lsun/nio/cs/ISO_8859_1$1;)V +17 -1: unwrapWithNoPrims +17 -1: instanceof Long: +20 -1: hasRealParameterData +23 -1: ()Ljava/time/LocalTime; +14 -1: getAnnotations +8 -1: optimize +7 -1: setChar +11 -1: OFFSET_MASK +4 -1: TYPE +177 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/BiFunction;Ljava/util/concurrent/atomic/AtomicReference;)V +18 -1: removeShutdownHook +27 -1: ()Ljava/security/Principal; +29 -1: JAVAFX_APPLICATION_CLASS_NAME +6 -1: digits +37 -1: [Ljava/lang/reflect/Constructor; +45 -1: ()Ljava/lang/Thread$UncaughtExceptionHandler; +7 -1: tryLock +19 -1: java/net/Proxy$Type +21 -1: setJavaSecurityAccess +13 -1: tieBreakOrder +3 -1: no +16 -1: Australia/Sydney +13 -1: DAY_IN_MILLIS +19 -1: ()Ljava/nio/Buffer; +12 -1: Integer.java +14 -1: isBmpCodePoint +6 -1: daemon +23 -1: Lsun/misc/JavaIOAccess; +106 -1: (JLjava/util/function/BiFunction<-TK;-TV;+TU;>;Ljava/util/function/Consumer<-TU;>;)V +10 -1: getFloatAt +15 -1: content/unknown +52 -1: ()Ljava/util/Enumeration<+Ljava/util/zip/ZipEntry;>; +123 -1: (Ljava/lang/Class<*>;Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z +4 -1: nsme +12 -1: prefixLength +9 -1: flagsMods +95 -1: (BLjava/lang/invoke/MemberName;Ljava/lang/Class;Ljava/lang/Class;)Ljava/lang/invoke/MemberName; +62 -1: (Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/LambdaForm; +16 -1: Illegal mode: 0x +24 -1: java/io/FileOutputStream +41 -1: [Pp][Ee][Rr][Mm][Ii][Ss][Ss][Ii][Oo][Nn]= +24 -1: java/security/CodeSource +16 -1: DUMP_CLASS_FILES +25 -1: ([C)Ljava/nio/CharBuffer; +12 -1: bindArgument +50 -1: Ljava/lang/ref/FinalReference; +21 -1: unmodifiableSortedMap +10 -1: jarHandler +73 -1: (Ljava/lang/Class;[Ljava/lang/reflect/Method;)[Ljava/lang/reflect/Method; +67 -1: ()Ljava/util/Map; +15 -1: threadSeqNumber +18 -1: AutoCloseable.java +9 -1: holdsLock +25 -1: (Ljava/lang/Object;JJJJ)V +7 -1: (IJII)I +15 -1: copyToLongArray +58 -1: Ljava/util/HashMap; +84 -1: (Ljava/lang/invoke/MethodHandle;I[Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle; +32 -1: getExecutableTypeAnnotationBytes +17 -1: streamHandlerLock +35 -1: java/lang/IndexOutOfBoundsException +15 -1: moveRootToFront +28 -1: ()Ljava/nio/file/FileSystem; +14 -1: content-length +61 -1: (Ljava/lang/invoke/CallSite;Ljava/lang/invoke/MethodHandle;)V +7 -1: csASCII +18 -1: staticIsConsistent +21 -1: sharedToGenericString +8 -1: linkLast +21 -1: isUnicodeExtensionKey +7 -1: readInt +7 -1: compile +32 -1: ()Ljava/lang/reflect/Executable; +4 -1: Big5 +20 -1: Ljava/util/Set; +18 -1: ExpiringCache.java +44 -1: (Ljava/lang/String;[BII)Ljava/lang/Class<*>; +18 -1: LinkedHashMap.java +32 -1: Ljava/lang/UnsatisfiedLinkError; +13 -1: parameterType +28 -1: (ID)Ljava/lang/StringBuffer; +15 -1: synchronizedSet +9 -1: implClose +6 -1: member +14 -1: MH_INVOKE_MODS +21 -1: forOutputStreamWriter +37 -1: Lsun/misc/JavaIOFileDescriptorAccess; +28 -1: java/lang/ProcessEnvironment +17 -1: setNormalizedYear +14 -1: isMalformed4_2 +14 -1: isMalformed4_3 +38 -1: (Ljava/lang/Object;)Ljava/lang/String; +16 -1: getJavaAWTAccess +12 -1: isPrivileged +30 -1: java/util/Collections$EmptyMap +17 -1: LinkedKeyIterator +7 -1: vmcount +27 -1: java/lang/ref/WeakReference +5 -1: march +13 -1: addOldMapping +58 -1: (Ljava/lang/Object;Ljava/lang/Runnable;)Lsun/misc/Cleaner; +56 -1: (ILjava/lang/String;)[Ljava/lang/invoke/LambdaForm$Name; +65 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesToLongTask +55 -1: (Ljava/lang/invoke/SerializedLambda;)Ljava/lang/Object; +17 -1: getEnclosingClass +35 -1: (I)Lsun/util/calendar/BaseCalendar; +13 -1: binarySearch0 +25 -1: ([J)Ljava/nio/LongBuffer; +19 -1: java/util/Map$Entry +22 -1: java/util/HashMap$Node +26 -1: sun/reflect/MethodAccessor +8 -1: LASTYEAR +7 -1: disable +36 -1: sun/launcher/LauncherHelper$FXHelper +6 -1: toPath +10 -1: shortValue +6 -1: remove +59 -1: ([Ljava/lang/String;[Ljava/lang/String;)Ljava/lang/Process; +55 -1: java/util/concurrent/ConcurrentHashMap$ValueSpliterator +64 -1: (Ljava/util/Collection;Ljava/lang/Object;)Ljava/util/Collection; +15 -1: asPrimitiveType +16 -1: PrintStream.java +10 -1: image/jpeg +22 -1: specificToStringHeader +7 -1: class " +38 -1: java/util/Collections$CheckedSortedMap +19 -1: SUPPRESSED_SENTINEL +16 -1: getEnumConstants +54 -1: (ILjava/lang/CharSequence;II)Ljava/lang/StringBuilder; +36 -1: Ljava/lang/Class; +13 -1: toThreadState +38 -1: (Ljava/lang/Class;)Ljava/lang/Package; +24 -1: (C)Ljava/lang/Character; +19 -1: UNTREEIFY_THRESHOLD +4 -1: NCPU +23 -1: ()Ljava/lang/Exception; +42 -1: (ITK;TV;Ljava/util/HashMap$Node;)V +15 -1: nothingToVerify +15 -1: setInitialValue +15 -1: getTimeInMillis +12 -1: getDoubleAt0 +18 -1: parameterTypeCache +86 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind;)Ljava/nio/file/WatchKey; +49 -1: java/util/concurrent/ConcurrentHashMap$ValuesView +13 -1: +7 -1: exitVM. +34 -1: Ljava/lang/ClassNotFoundException; +68 -1: (Ljava/util/Map;Ljava/lang/Class;)[Ljava/lang/annotation/Annotation; +28 -1: getCalendarDateFromFixedDate +28 -1: UnsafeFieldAccessorImpl.java +27 -1: java/lang/RuntimePermission +74 -1: Ljava/lang/Object;Ljava/lang/Comparable; +62 -1: ()Ljava/util/Iterator; +13 -1: LanguageRange +239 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesToIntTask;Ljava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)V +37 -1: DIRECTIONALITY_LEFT_TO_RIGHT_OVERRIDE +62 -1: (Ljava/lang/invoke/MethodType;II)Ljava/lang/invoke/MethodType; +16 -1: DMH.invokeStatic +11 -1: (TK;TV;)TV; +7 -1: ([FI)[F +14 -1: newPerfCounter +35 -1: ([JI)Ljava/util/Spliterator$OfLong; +30 -1: java/util/AbstractList$ListItr +5 -1: cp912 +5 -1: cp914 +45 -1: (Ljava/io/BufferedWriter;Ljava/lang/String;)V +6 -1: LOCNAM +8 -1: launcher +5 -1: cp915 +14 -1: standardString +26 -1: ()Ljava/lang/Thread$State; +10 -1: L_ALPHANUM +8 -1: (C[CII)I +9 -1: SEPTEMBER +20 -1: java/text/DateFormat +38 -1: Ljava/lang/CloneNotSupportedException; +5 -1: cp920 +23 -1: getConstructorSignature +16 -1: ReferenceHandler +19 -1: America/Puerto_Rico +5 -1: cp923 +10 -1: typeString +30 -1: Self-suppression not permitted +25 -1: (Ljava/io/OutputStream;)V +9 -1: implReset +12 -1: fullAddCount +34 -1: java/lang/invoke/LambdaForm$Hidden +25 -1: ()Lsun/misc/JavaIOAccess; +9 -1: Math.java +9 -1: getAndSet +7 -1: failure +14 -1: LINE_SEPARATOR +6 -1: parent +30 -1: java/lang/BootstrapMethodError +8 -1: indexMap +9 -1: ALL_KINDS +23 -1: desiredAssertionStatus0 +39 -1: (ILjava/lang/Object;)Ljava/lang/Object; +22 -1: RuntimePermission.java +21 -1: getContextClassLoader +14 -1: VARARGS_INVOKE +8 -1: zoneinfo +130 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;ILjava/lang/invoke/DirectMethodHandle$1;)V +18 -1: java/lang/Readable +11 -1: containsAll +11 -1: newPosition +57 -1: sun/reflect/InstantiationExceptionConstructorAccessorImpl +13 -1: REVERSE_ORDER +29 -1: Required array size too large +6 -1: sunday +44 -1: ()Ljava/util/Set; +10 -1: toIntExact +33 -1: ([BIILjava/nio/charset/Charset;)V +14 -1: indexOfSubList +15 -1: tryAcquireNanos +31 -1: java/lang/InvalidClassException +22 -1: SecureClassLoader.java +12 -1: proxiedHosts +7 -1: ([CII)I +11 -1: toHexString +30 -1: sun/util/calendar/ZoneInfoFile +31 -1: Ljava/util/jar/Attributes$Name; +10 -1: L_USERINFO +25 -1: (IB)Ljava/nio/ByteBuffer; +11 -1: parseDouble +7 -1: ([CII)V +13 -1: Asia/Shanghai +5 -1: [...] +57 -1: ([Ljava/lang/Class;[B)[[Ljava/lang/annotation/Annotation; +19 -1: java/nio/LongBuffer +15 -1: getCertificates +9 -1: comparing +83 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;IILjava/lang/String;[B)V +43 -1: Ljava/util/concurrent/atomic/AtomicInteger; +23 -1: toFieldDescriptorString +20 -1: Lsun/misc/MetaIndex; +37 -1: java/util/Collections$UnmodifiableSet +5 -1: (JC)V +37 -1: nanosecond timeout value out of range +26 -1: AbstractStringBuilder.java +43 -1: java/lang/invoke/DirectMethodHandle$Special +49 -1: ([Ljava/nio/file/LinkOption;)Ljava/nio/file/Path; +15 -1: currentPosition +14 -1: java/net/Proxy +13 -1: asConstructor +8 -1: userInfo +14 -1: parseClassPath +15 -1: legacyMergeSort +34 -1: java/security/UnresolvedPermission +97 -1: Lsun/util/locale/LocaleObjectCache; +9 -1: freeEntry +19 -1: delimiterCodePoints +34 -1: Should be non-empty if initialized +23 -1: (I)Ljava/lang/Class<*>; +11 -1: Reader.java +26 -1: checkClassLoaderPermission +27 -1: java/nio/DirectShortBufferS +95 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction; +27 -1: java/nio/DirectShortBufferU +20 -1: ()[Ljava/lang/Class; +56 -1: ()[Ljava/util/concurrent/ConcurrentHashMap$Node; +19 -1: sun/nio/cs/UTF_16BE +24 -1: java/util/AbstractList$1 +10 -1: ([CIIIII)V +60 -1: Ljava/lang/Object;Ljava/lang/Comparable; +37 -1: (Ljava/lang/invoke/LambdaForm$Name;)S +9 -1: putDouble +52 -1: ([Ljava/security/CodeSource;)Ljava/util/Enumeration; +37 -1: (Ljava/lang/invoke/LambdaForm$Name;)Z +22 -1: ()[Ljava/lang/Package; +41 -1: java/lang/CharSequence$1CodePointIterator +13 -1: auditSubclass +24 -1: Ljava/util/jar/JarEntry; +20 -1: findMethodHandleType +15 -1: MAX_BUFFER_SIZE +19 -1: FilePermission.java +18 -1: WrappedPrintStream +36 -1: (D)Ljava/lang/AbstractStringBuilder; +11 -1: unfinalized +10 -1: getFileURL +37 -1: (Ljava/io/FileFilter;)[Ljava/io/File; +54 -1: (Ljava/nio/ByteBuffer;I)Ljava/nio/charset/CoderResult; +7 -1: ([ZI)[Z +64 -1: (Ljava/security/CodeSource;)Ljava/security/PermissionCollection; +6 -1: PUBLIC +83 -1: (Ljava/util/jar/JarFile;Ljava/net/URL;Ljava/lang/String;)Ljava/security/CodeSource; +17 -1: lockInterruptibly +67 -1: ([Ljava/util/Hashtable$Entry;Ljava/lang/Object;Ljava/lang/Object;)V +42 -1: java/util/ArraysParallelSortHelpers$FJChar +21 -1: defaultCharBufferSize +14 -1: unalignedKnown +23 -1: ()Ljava/net/Proxy$Type; +4 -1: TZDB +14 -1: CharacterCache +13 -1: lengthOfMonth +13 -1: hasExtensions +23 -1: Prefix string too short +15 -1: Executable.java +10 -1: forEachKey +6 -1: getEra +13 -1: appendEncoded +21 -1: java/util/AbstractMap +10 -1: access$100 +10 -1: access$102 +30 -1: javafx.application.Application +46 -1: (Ljava/lang/Thread$UncaughtExceptionHandler;)V +43 -1: Ljava/lang/invoke/LambdaForm$NamedFunction; +101 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;IILjava/lang/String;[B)Ljava/lang/reflect/Field; +9 -1: WILD_CHAR +21 -1: SynchronizedSortedSet +28 -1: (Ljava/util/Collection<*>;)Z +29 -1: (I[C)Ljava/lang/StringBuffer; +65 -1: (Ljava/lang/String;[Ljava/lang/Class;Z)Ljava/lang/reflect/Method; +7 -1: putByte +6 -1: H_MARK +49 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/Object; +98 -1: ([Ljava/lang/ClassValue$Entry<*>;ILjava/lang/ClassValue$Entry<*>;Z)Ljava/lang/ClassValue$Entry<*>; +23 -1: array is not of length +52 -1: (Ljava/util/List;TT;TT;)Z +41 -1: Ljava/util/Collections$EmptyListIterator; +8 -1: +11 -1: updateCheck +29 -1: getBootClassPathEntryForClass +27 -1: sun/nio/cs/US_ASCII$Encoder +10 -1: bindCaller +18 -1: Ljava/util/BitSet; +10 -1: checkRange +77 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;Ljava/lang/Void;)V +7 -1: Classes +6 -1: store0 +23 -1: java/lang/Thread$Caches +25 -1: Ljava/lang/CharacterData; +7 -1: (JI[C)V +49 -1: (Ljava/util/LinkedList;Ljava/util/LinkedList$1;)V +16 -1: getGcInfoBuilder +12 -1: counterCells +14 -1: memoryLimitSet +7 -1: , nojit +9 -1: sharpsMap +7 -1: october +13 -1: isProxiedHost +9 -1: rawOffset +18 -1: toJavaFormatString +19 -1: sun.boot.class.path +60 -1: (ILjava/lang/CharSequence;)Ljava/lang/AbstractStringBuilder; +11 -1: spliterator +13 -1: contentLength +18 -1: unixTimeToFileTime +31 -1: Lsun/reflect/LangReflectAccess; +16 -1: while Java has +79 -1: (JLjava/util/function/ToIntBiFunction;ILjava/util/function/IntBinaryOperator;)I +12 -1: timeEndOfDay +17 -1: getCustomTimeZone +25 -1: Ljava/lang/ref/Reference; +20 -1: ()Ljava/util/Locale; +64 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;Z)V +13 -1: MAX_JVM_ARITY +72 -1: (Ljava/lang/String;Ljava/lang/ClassLoader;)Ljava/lang/invoke/MethodType; +11 -1: AsLIFOQueue +84 -1: (Ljava/util/List;Ljava/lang/Object;)Ljava/util/List; +12 -1: mappingCount +29 -1: (Ljava/io/FileOutputStream;)V +50 -1: (Ljava/util/List<-TT;>;TT;)V +23 -1: Category cannot be NULL +10 -1: normalized +5 -1: CLASS +28 -1: (IZ)Ljava/lang/StringBuffer; +18 -1: java/lang/System$1 +18 -1: java/lang/System$2 +9 -1: getResult +44 -1: ()Ljava/util/Collection; +8 -1: isNative +59 -1: Ljava/lang/Number;Ljava/lang/Comparable; +24 -1: [Ljava/lang/ThreadGroup; +24 -1: (B)Ljava/nio/ByteBuffer; +4 -1: READ +44 -1: (Ljava/io/FilePermission;)Ljava/lang/String; +93 -1: Ljava/util/Collections$SynchronizedCollection;Ljava/util/Set; +12 -1: compileClass +12 -1: isProxyClass +20 -1: isSystemDomainLoader +74 -1: (Ljava/util/List;Ljava/util/Comparator<-TT;>;)V +7 -1: getMask +72 -1: (Ljava/lang/ClassLoader;Ljava/lang/SecurityManager;Ljava/lang/String;I)V +20 -1: removeLastOccurrence +64 -1: (Ljava/lang/reflect/Field;)Ljava/lang/invoke/DirectMethodHandle; +57 -1: ()Ljava/util/Map;>; +11 -1: parkBlocker +40 -1: (Lsun/misc/JarIndex;Ljava/lang/String;)V +33 -1: [Ljava/security/ProtectionDomain; +14 -1: setContentType +14 -1: getEnumeration +18 -1: ProtectionDomain +76 -1: (Lsun/util/calendar/BaseCalendar$Date;)Lsun/util/calendar/BaseCalendar$Date; +16 -1: setRequestMethod +52 -1: (Ljava/util/List;Ljava/lang/Object;)Ljava/util/List; +32 -1: Lsun/util/calendar/BaseCalendar; +52 -1: (Ljava/net/URL;Ljava/lang/String;)Ljava/lang/String; +5 -1: .:@[] +7 -1: addLast +21 -1: AnnotatedElement.java +10 -1: defaultVal +16 -1: getCanonicalPath +17 -1: protection_domain +9 -1: strictfp +19 -1: sun/nio/cs/UTF_16LE +9 -1: readBytes +18 -1: removeStaleEntries +46 -1: java/util/Collections$UnmodifiableNavigableSet +5 -1: cpath +14 -1: COPY_THRESHOLD +8 -1: permsMap +8 -1: japanese +33 -1: java/nio/charset/StandardCharsets +47 -1: Lsun/reflect/DelegatingConstructorAccessorImpl; +19 -1: NF_checkGenericType +40 -1: java/util/Collections$UnmodifiableList$1 +4 -1: TERM +48 -1: The following can be used with stack and domain: +27 -1: ([BII)Ljava/nio/ByteBuffer; +40 -1: Ljava/util/Vector;>; +5 -1: digit +7 -1: isFinal +39 -1: (Ljava/lang/String;Ljava/lang/String;)I +26 -1: memberDeclaringClassOrNull +10 -1: ([CI[BII)I +38 -1: (Ljava/lang/Class;I)Ljava/lang/Object; +15 -1: isValidProtocol +17 -1: (this Collection) +11 -1: getTreeNode +16 -1: ThreadLocal.java +23 -1: java/nio/HeapLongBuffer +39 -1: (Ljava/lang/String;Ljava/lang/String;)V +12 -1: getNextEntry +39 -1: (Ljava/lang/String;Ljava/lang/String;)Z +28 -1: (C)Lsun/invoke/util/Wrapper; +9 -1: readFloat +21 -1: overrideFieldAccessor +16 -1: fillInStackTrace +16 -1: getDeclaredField +5 -1: deflt +8 -1: nextChar +10 -1: primCounts +22 -1: getAnnotatedInterfaces +26 -1: ()Ljava/util/zip/Inflater; +73 -1: (JLjava/util/function/BiFunction<-TK;-TV;+TU;>;)TU; +16 -1: traceMethodCalls +10 -1: sun.nio.cs +7 -1: marshal +9 -1: ftypeKind +77 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class;)Ljava/lang/invoke/MemberName; +11 -1: sun/misc/VM +14 -1: GuardWithCatch +40 -1: (Ljava/lang/Object;)Ljava/util/Iterator; +13 -1: subtractExact +42 -1: (Ljava/lang/Object;ILjava/lang/Object;II)V +10 -1: isInfinite +18 -1: sun.util.calendar. +14 -1: java/lang/Math +16 -1: java/lang/String +10 -1: encodePath +14 -1: compactAndTrim +11 -1: getVariants +4 -1: from +47 -1: (Ljava/lang/ThreadLocal<*>;Ljava/lang/Object;)V +35 -1: serializeAgentPropertiesToByteArray +16 -1: computeIfPresent +9 -1: EMPTY_MAP +28 -1: java/lang/InstantiationError +68 -1: (Ljava/util/Comparator;Ljava/util/Comparator;)Ljava/util/Comparator; +14 -1: getDisplayName +14 -1: limitedContext +23 -1: usagetracker.properties +52 -1: java/util/concurrent/locks/ReentrantLock$NonfairSync +7 -1: public +17 -1: srcBegin > srcEnd +48 -1: (ILjava/util/List;)Ljava/lang/invoke/MethodType; +21 -1: java/lang/ThreadDeath +9 -1: gregorian +111 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;ILjava/lang/Object;Ljava/lang/Object;)Ljava/util/HashMap$TreeNode; +52 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;III)V +12 -1: generateFile +20 -1: appendParameterTypes +22 -1: sun/misc/FileURLMapper +13 -1: defaultDomain +25 -1: (I)Ljava/time/ZoneOffset; +21 -1: getBooleanAttributes0 +39 -1: (Ljava/lang/String;)Lsun/misc/Resource; +43 -1: Ljava/lang/Thread$UncaughtExceptionHandler; +23 -1: getTypeAnnotationBytes0 +8 -1: ELOT_928 +32 -1: sun/nio/cs/FastCharsetProvider$1 +34 -1: Ljava/nio/BufferOverflowException; +14 -1: AppClassLoader +10 -1: protected +12 -1: isAnnotation +16 -1: PerfCounter.java +51 -1: Ljava/util/Map; +160 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object; +11 -1: setLeapYear +16 -1: parseContextSpec +16 -1: setFieldAccessor +8 -1: writeInt +16 -1: java/lang/Number +33 -1: java/util/AbstractMap$SimpleEntry +9 -1: nextTable +8 -1: getQuery +14 -1: putOrderedLong +93 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)V +52 -1: (Ljava/lang/String;)Lsun/reflect/generics/tree/Tree; +85 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/concurrent/ConcurrentHashMap$Node;)V +9 -1: singleton +9 -1: destroyed +15 -1: iso_8859-2:1987 +12 -1: comparingInt +29 -1: [Ljava/lang/OutOfMemoryError; +39 -1: (Ljava/lang/String;Ljava/lang/Object;)V +27 -1: ([Ljava/util/Enumeration;)V +36 -1: Ljava/nio/charset/CodingErrorAction; +16 -1: getCanonicalName +41 -1: (Ljava/nio/LongBuffer;)Ljava/util/BitSet; +15 -1: DISPLAY_COUNTRY +32 -1: getFunctionalInterfaceMethodName +66 -1: (Ljava/lang/String;Ljava/util/Map;Ljava/util/Map;Ljava/util/Map;)V +24 -1: getUnresolvedPermissions +66 -1: ([Ljava/lang/ClassValue$Entry<*>;I)Ljava/lang/ClassValue$Entry<*>; +41 -1: ()Lsun/reflect/annotation/AnnotationType; +7 -1: afIndex +7 -1: csascii +20 -1: ()Ljava/util/Vector; +16 -1: EntrySpliterator +53 -1: (Ljava/lang/Throwable;I)Ljava/lang/StackTraceElement; +81 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;)Ljava/lang/invoke/MethodHandle; +20 -1: classAssertionStatus +7 -1: EXECUTE +21 -1: ()Ljava/lang/Runtime; +6 -1: cesu-8 +7 -1: offset +23 -1: Ljava/lang/SafeVarargs; +34 -1: (Ljava/util/LinkedHashMap$Entry;)V +8 -1: entryFor +8 -1: getCache +46 -1: (Ljava/lang/Object;I)Ljava/lang/reflect/Field; +4 -1: skip +8 -1: (II[CI)V +4 -1: vart +12 -1: InnerClasses +68 -1: (Ljava/util/Map;Ljava/lang/Class;[Ljava/lang/String;)Ljava/util/Map; +19 -1: currentClassLoader0 +34 -1: getDefaultUncaughtExceptionHandler +11 -1: String.java +117 -1: (Ljava/lang/ThreadLocal<*>;ILjava/lang/ThreadLocal$ThreadLocalMap$Entry;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry; +7 -1: january +31 -1: (ILjava/lang/String;IIIIIIIII)V +24 -1: Lsun/misc/JavaAWTAccess; +5 -1: .path +15 -1: [Ljava/io/File; +11 -1: Writer.java +8 -1: , Size: +159 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/Function;Ljava/util/function/Consumer;)V +32 -1: java/lang/invoke/LambdaForm$Name +51 -1: (Ljava/util/ArrayList;Ljava/util/AbstractList;III)V +7 -1: getZone +14 -1: JIS_X0212-1990 +21 -1: (Ljava/util/Set<*>;)Z +149 -1: (Lsun/util/locale/provider/LocaleServiceProviderPool$LocalizedObjectGetter;Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/lang/Object; +21 -1: Illegal Load factor: +35 -1: ()Ljava/lang/invoke/MethodTypeForm; +22 -1: ([Z)Ljava/lang/String; +7 -1: setName +48 -1: (TT;Ljava/lang/String;)TT; +9 -1: INTERFACE +22 -1: ARRAY_CHAR_INDEX_SCALE +19 -1: java/nio/ByteBuffer +23 -1: Ljava/io/ExpiringCache; +7 -1: streams +44 -1: java/lang/invoke/DirectMethodHandle$Accessor +36 -1: ([Ljava/security/ProtectionDomain;)V +16 -1: afterNodeRemoval +9 -1: prevIndex +49 -1: java/util/concurrent/ConcurrentHashMap$KeySetView +22 -1: getEnumConstantsShared +17 -1: java/lang/Integer +12 -1: getRawOffset +36 -1: ()Ljava/nio/file/attribute/FileTime; +7 -1: offsets +10 -1: ] throw => +3 -1: [[B +10 -1: hostsEqual +18 -1: compareComparables +35 -1: sun/reflect/ConstructorAccessorImpl +8 -1: december +36 -1: Invalid binary time-zone data: TZDB: +24 -1: synchronizedNavigableMap +72 -1: sun/util/locale/provider/LocaleServiceProviderPool$LocalizedObjectGetter +19 -1: parseCustomTimeZone +88 -1: (Ljava/lang/Class<*>;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle; +9 -1: findClass +6 -1: OBJECT +3 -1: GBK +110 -1: (JLjava/util/function/ToLongFunction;>;JLjava/util/function/LongBinaryOperator;)J +6 -1: UTF_16 +17 -1: +13 -1: lookupCharset +28 -1: ConstructorAccessorImpl.java +62 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysToLongTask +30 -1: Ljava/lang/ClassCastException; +56 -1: ()Ljava/util/Spliterator;>; +11 -1: invokerType +23 -1: java/lang/StringBuilder +12 -1: deleteCharAt +11 -1: CR_OVERFLOW +14 -1: toExternalForm +3 -1: out +34 -1: Ljava/net/URLStreamHandlerFactory; +15 -1: encodeArrayLoop +30 -1: ()Ljava/util/Enumeration; +27 -1: java/io/SyncFailedException +10 -1: checkedSet +16 -1: checkedSortedSet +22 -1: java/util/zip/ZipEntry +43 -1: java/util/LinkedHashMap$LinkedValueIterator +22 -1: UnmodifiableCollection +32 -1: java/nio/ByteBufferAsCharBufferB +11 -1: blockerLock +27 -1: checkExtensionsDependencies +11 -1: fromIndex: +32 -1: java/nio/ByteBufferAsCharBufferL +6 -1: UTF_32 +30 -1: java/util/Hashtable$Enumerator +92 -1: (Ljava/util/Map<+TK;+TV;>;)Ljava/util/Map; +4 -1: tail +5 -1: (BB)C +16 -1: isValidSignature +9 -1: addMillis +9 -1: peekFirst +86 -1: (Ljava/util/Set;Ljava/lang/Class;)Ljava/util/Set; +5 -1: (BB)I +15 -1: jvmMicroVersion +28 -1: [Ljava/util/Hashtable$Entry; +15 -1: iso_8859-5:1988 +14 -1: HOUR_IN_MILLIS +67 -1: (Ljava/util/PrimitiveIterator$OfInt;I)Ljava/util/Spliterator$OfInt; +5 -1: (BB)S +21 -1: UnmodifiableSortedMap +79 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/concurrent/ConcurrentHashMap;)V +56 -1: Ljava/util/Stack; +5 -1: (BB)Z +10 -1: treeifyBin +8 -1: isOpaque +27 -1: java.launcher.ergo.message1 +27 -1: java.launcher.ergo.message2 +101 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Cloneable;Ljava/lang/Comparable; +31 -1: (Ljava/io/ObjectOutputStream;)V +3 -1: GET +13 -1: matchLocation +13 -1: WrappedMember +63 -1: NoSuchMethodException:\n could not find proper constructor for +14 -1: gssloginconfig +70 -1: (Ljava/util/LinkedList$Node;TE;Ljava/util/LinkedList$Node;)V +57 -1: (Ljava/lang/Object;Ljava/lang/Object;Z)Ljava/lang/Object; +11 -1: toByteArray +49 -1: java/util/ArraysParallelSortHelpers$FJByte$Sorter +13 -1: no protocol: +940 -1: aaaarababkaeaveafafrakakaamamhanargararaasasmavavaayaymazazebabakbebelbgbulbhbihbibisbmbambnbenbobodbrbrebsboscacatcechechchacocoscrcrecscescuchucvchvcycymdadandedeudvdivdzdzoeeeweelellenengeoepoesspaetesteueusfafasfffulfifinfjfijfofaofrfrafyfrygaglegdglaglglggngrngugujgvglvhahauhehebhihinhohmohrhrvhthathuhunhyhyehzheriainaidindieileigiboiiiiiikipkinindioidoisislititaiuikuiwhebjajpnjiyidjvjavkakatkgkonkikikkjkuakkkazklkalkmkhmknkankokorkrkaukskaskukurkvkomkwcorkykirlalatlbltzlgluglilimlnlinlolaoltlitlulublvlavmgmlgmhmahmimrimkmkdmlmalmnmonmomolmrmarmsmsamtmltmymyananaunbnobndndenenepngndonlnldnnnnononornrnblnvnavnynyaocociojojiomormororiososspapanpipliplpolpspusptporququermrohrnrunroronrurusrwkinsasanscsrdsdsndsesmesgsagsisinskslkslslvsmsmosnsnasosomsqsqisrsrpsssswstsotsusunsvsweswswatatamteteltgtgkththatitirtktuktltgltntsntotontrturtstsotttattwtwitytahuguigukukrururduzuzbvevenvivievovolwawlnwowolxhxhoyiyidyoyorzazhazhzhozuzul +42 -1: java/util/LinkedHashMap$LinkedHashIterator +39 -1: java/util/ArrayDeque$DescendingIterator +15 -1: MODIFIER_LETTER +21 -1: (Lsun/misc/Cleaner;)Z +12 -1: PACKAGE_NAME +14 -1: getMappedValue +10 -1: interrupt0 +8 -1: LF_LIMIT +17 -1: getDeclaringClass +42 -1: (ZILjava/lang/String;)Ljava/lang/Class<*>; +57 -1: (Ljava/lang/management/ThreadInfo;[Ljava/lang/Object;[I)V +15 -1: java/nio/Bits$1 +61 -1: (Ljava/lang/String;ZLjava/lang/ClassLoader;)Ljava/lang/Class; +28 -1: java/lang/ref/ReferenceQueue +33 -1: [Ljava/security/cert/Certificate; +44 -1: (Ljava/util/Hashtable;I)Ljava/util/Iterator; +24 -1: java/security/CodeSigner +19 -1: Non-positive length +24 -1: [Ljava/util/Enumeration; +38 -1: ()Ljava/security/PermissionCollection; +16 -1: checkGenericType +56 -1: java/util/concurrent/ConcurrentHashMap$ReduceEntriesTask +7 -1: getYear +5 -1: atime +19 -1: Ljava/util/HashMap; +125 -1: (JLjava/util/function/Function;+TU;>;Ljava/util/function/Consumer<-TU;>;)V +22 -1: STOP_THREAD_PERMISSION +46 -1: (Ljava/util/Enumeration;)Ljava/util/ArrayList; +16 -1: getPathSeparator +10 -1: getMembers +8 -1: getIntAt +26 -1: java/io/File$TempDirectory +48 -1: java/lang/invoke/MethodHandleImpl$GuardWithCatch +25 -1: CaseInsensitiveComparator +8 -1: pollLast +21 -1: GET_POLICY_PERMISSION +23 -1: uninitialized call site +75 -1: (Ljava/util/function/Function;Ljava/util/Comparator;)Ljava/util/Comparator; +9 -1: directory +51 -1: (JLjava/util/function/BiFunction<-TV;-TV;+TV;>;)TV; +41 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;)V +42 -1: (Ljava/lang/Throwable;Ljava/lang/String;)V +26 -1: (FLjava/lang/Appendable;)V +5 -1: stop0 +9 -1: substring +64 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/HashMap$Node;)V +5 -1: (JD)V +9 -1: getShortB +10 -1: nextOrSame +24 -1: [ interpretWithArguments +6 -1: GB2312 +32 -1: java/nio/BufferOverflowException +23 -1: sun/nio/cs/ArrayEncoder +4 -1: tanh +9 -1: getShortL +55 -1: (JLjava/util/function/BiFunction;)Ljava/util/Map$Entry; +10 -1: getMessage +12 -1: findTreeNode +38 -1: DIRECTIONALITY_COMMON_NUMBER_SEPARATOR +23 -1: [Ljava/lang/Comparable; +17 -1: getCallSiteTarget +55 -1: (Ljava/nio/ByteBuffer;II)Ljava/nio/charset/CoderResult; +19 -1: java/util/ArrayList +17 -1: java/io/DataInput +13 -1: getPrincipals +52 -1: (TE;)Ljava/util/Iterator; +44 -1: sun/reflect/generics/tree/ClassTypeSignature +6 -1: loaded +20 -1: ()Ljava/lang/Object; +36 -1: Ljava/util/concurrent/ConcurrentMap; +13 -1: classValueMap +33 -1: java/lang/SystemClassLoaderAction +6 -1: loader +31 -1: java/lang/annotation/Annotation +5 -1: colon +11 -1: Vector.java +24 -1: CharacterDataLatin1.java +12 -1: setUseCaches +22 -1: getTypeAnnotationBytes +9 -1: readShort +24 -1: longPrimitiveReturnCount +5 -1: get16 +34 -1: setDefaultUncaughtExceptionHandler +17 -1: cachedInputStream +29 -1: java/util/LinkedHashMap$Entry +17 -1: java/lang/Boolean +50 -1: ()[Lsun/reflect/generics/tree/FormalTypeParameter; +14 -1: AnnotationData +21 -1: Ljava/net/Proxy$Type; +13 -1: invokeVirtual +14 -1: Parameter.java +21 -1: getDayOfWeekDateAfter +92 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object; +56 -1: (Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object; +46 -1: sun/util/locale/provider/LocaleProviderAdapter +29 -1: Ljava/lang/StackTraceElement; +47 -1: (TK;Ljava/util/function/Function<-TK;+TV;>;)TV; +32 -1: enableContextClassLoaderOverride +68 -1: (Ljava/lang/AbstractStringBuilder;)Ljava/lang/AbstractStringBuilder; +51 -1: Ljava/util/concurrent/ConcurrentHashMap$KeySetView; +9 -1: addAndGet +5 -1: store +7 -1: ([JII)V +15 -1: signatureReturn +18 -1: NF_reinvokerTarget +22 -1: ()Ljava/nio/file/Path; +25 -1: (C)Ljava/lang/Appendable; +7 -1: expires +18 -1: initializeInvokers +19 -1: application/java-vm +13 -1: stopOrSuspend +13 -1: rawOffsetDiff +6 -1: (JJZ)V +9 -1: findValue +5 -1: get32 +10 -1: asSubclass +6 -1: forJRE +3 -1: GMT +7 -1: delete0 +69 -1: ([Ljava/security/cert/Certificate;[Ljava/security/cert/Certificate;)Z +75 -1: (Ljava/util/LinkedList$Node;Ljava/lang/Object;Ljava/util/LinkedList$Node;)V +6 -1: setEra +24 -1: ()Ljava/util/Comparator; +10 -1: access$200 +10 -1: access$202 +20 -1: retrieveDisplayNames +3 -1: pae +24 -1: java/lang/Byte$ByteCache +7 -1: VM.java +9 -1: TRANSIENT +6 -1: setErr +16 -1: jdkUpdateVersion +10 -1: isResolved +35 -1: sun/misc/JavaIOFileDescriptorAccess +4 -1: char +13 -1: Readable.java +19 -1: UnixFileSystem.java +43 -1: (Ljava/lang/ThreadLocal;)Ljava/lang/Object; +40 -1: (Ljava/lang/String;[Ljava/lang/String;)V +7 -1: profile +11 -1: , version: +25 -1: PermissionCollection.java +13 -1: setNormalized +10 -1: access$210 +24 -1: (Ljava/lang/String;IJZ)J +19 -1: isAnnotationPresent +85 -1: (Ljava/util/Map;Ljava/lang/Class;Ljava/lang/Class;)[Ljava/lang/annotation/Annotation; +19 -1: DMH.invokeInterface +157 -1: Ljava/util/concurrent/ConcurrentHashMap$CollectionView;Ljava/util/Collection;Ljava/io/Serializable; +94 -1: Ljava/util/Collections$UnmodifiableCollection;Ljava/util/List; +41 -1: java/lang/StringIndexOutOfBoundsException +29 -1: java/net/UnknownHostException +11 -1: (BBBBBBBB)J +4 -1: iioe +12 -1: (TK;TV;Z)TV; +5 -1: ERROR +31 -1: (Ljava/io/File;Ljava/io/File;)I +32 -1: [Ljava/lang/invoke/MethodHandle; +27 -1: lambda$comparing$77a9974f$1 +13 -1: toLowerCaseEx +61 -1: (Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;)V +66 -1: (ILjava/lang/Object;Ljava/lang/Class;)Ljava/util/HashMap$TreeNode; +43 -1: java/util/concurrent/ConcurrentHashMap$Node +23 -1: latestUserDefinedLoader +24 -1: buildAnnotatedSuperclass +19 -1: compareToIgnoreCase +31 -1: (Ljava/io/File;Ljava/io/File;)Z +40 -1: (I[C)[Ljava/lang/invoke/LambdaForm$Name; +16 -1: ROTATE_THRESHOLD +18 -1: getClassAtIfLoaded +37 -1: java/lang/IllegalThreadStateException +5 -1: get64 +12 -1: writeReplace +14 -1: DAYS_PER_CYCLE +4 -1: _get +6 -1: nChars +26 -1: ()Ljava/net/SocketAddress; +27 -1: setUncaughtExceptionHandler +6 -1: jzfile +42 -1: All subclasses should override this method +3 2: Foo +56 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/lang/String; +136 -1: (Ljava/security/PrivilegedExceptionAction;Ljava/security/AccessControlContext;[Ljava/security/Permission;)TT; +3 -1: pdt +44 -1: sun/util/locale/LocaleObjectCache$CacheEntry +20 -1: java/util/Comparator +9 -1: suspended +11 -1: removeEntry +10 -1: SPACE_FREE +12 -1: processQueue +9 -1: java.home +5 -1: valid +23 -1: printEnclosedStackTrace +4 -1: push +5 -1: guard +23 -1: javaNetHttpCookieAccess +36 -1: (Ljava/security/cert/Certificate;)[B +9 -1: isWrapped +12 -1: CharIterator +26 -1: sun.io.useCanonPrefixCache +42 -1: (Lsun/misc/Cleaner;Ljava/lang/Throwable;)V +7 -1: prepare +8 -1: parseInt +13 -1: Invokers.java +63 -1: (Ljava/net/URLClassLoader;)Ljava/security/AccessControlContext; +18 -1: defaultWriteObject +5 -1: class +15 -1: EnclosingMethod +23 -1: ([BI)Ljava/lang/String; +16 -1: rangeCheckForAdd +11 -1: getTimeImpl +15 -1: arrayIndexScale +5 -1: scalb +5 -1: scale +45 -1: (Ljava/lang/String;J)Ljava/util/zip/ZipEntry; +8 -1: ([FIIF)I +16 -1: runAllFinalizers +27 -1: ()Lsun/net/ProgressMonitor; +15 -1: MemberName.java +27 -1: [Ljava/lang/reflect/Member; +6 -1: length +14 -1: genericInvoker +8 -1: ([FIIF)V +34 -1: Ljava/nio/file/attribute/FileTime; +6 -1: number +70 -1: (Ljava/lang/StringBuilder;Ljava/lang/String;)Ljava/lang/StringBuilder; +12 -1: printLocales +38 -1: java/lang/invoke/MethodHandleStatics$1 +8 -1: private +20 -1: invalid actions mask +10 -1: not found +13 -1: parseClassSig +22 -1: getAllAvailableLocales +175 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/Function;Ljava/util/concurrent/atomic/AtomicReference;)V +8 -1: ([BII)[B +35 -1: (Ljava/util/HashMap$Node;)V +132 -1: (Ljava/lang/Thread;ILjava/lang/Object;Ljava/lang/Thread;JJJJ[Ljava/lang/StackTraceElement;[Ljava/lang/Object;[I[Ljava/lang/Object;)V +8 -1: ([BII)[C +20 -1: DECIMAL_DIGIT_NUMBER +40 -1: (Ljava/lang/String;[Ljava/lang/Object;)Z +7 -1: ([CCI)I +64 -1: (TV;)Ljava/util/concurrent/ConcurrentHashMap$KeySetView; +8 -1: aliasMap +8 -1: checkfpx +44 -1: java/util/Comparators$NaturalOrderComparator +48 -1: (Ljava/lang/ClassLoader;)Ljava/lang/ClassLoader; +12 -1: Name is null +10 -1: invoke_L_L +8 -1: URL.java +51 -1: (JILjava/time/ZoneOffset;)Ljava/time/LocalDateTime; +25 -1: Lsun/invoke/util/Wrapper; +19 -1: LauncherHelper.java +10 -1: invoke_L_V +5 -1: index +30 -1: sun/security/x509/X509CertImpl +8 -1: addClass +46 -1: (I)Ljava/lang/invoke/LambdaForm$NamedFunction; +20 -1: refKindIsConstructor +10 -1: getFieldAt +5 -1: log10 +13 -1: GetPerfAction +15 -1: isLetterOrDigit +27 -1: hasCheckedSpecialAttributes +25 -1: MapReduceEntriesToIntTask +17 -1: probeHomeLocation +9 -1: image/png +19 -1: checkSpreadArgument +12 -1: LinkedKeySet +13 -1: removeMapping +39 -1: sun/security/util/SecurityConstants$AWT +9 -1: MAX_RADIX +28 -1: (F)Ljava/lang/StringBuilder; +11 -1: ([C[B[I[I)Z +36 -1: (Ljava/lang/Class;)Ljava/lang/Class; +32 -1: java/lang/invoke/MagicLambdaImpl +6 -1: monday +16 -1: closeClassLoader +41 -1: (Ljava/util/concurrent/locks/Condition;)I +8 -1: reversed +27 -1: sun/util/calendar/Gregorian +49 -1: (Lsun/nio/cs/FastCharsetProvider;)Ljava/util/Map; +42 -1: (Ljava/lang/String;Ljava/lang/Throwable;)V +18 -1: java/util/Calendar +8 -1: vmtarget +17 -1: TREEIFY_THRESHOLD +41 -1: (Ljava/util/concurrent/locks/Condition;)Z +9 -1: deadChild +8 -1: EntrySet +5 -1: log1p +58 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/util/HashMap;)V +9 -1: pageCount +14 -1: slotToArgTable +24 -1: toMethodDescriptorString +25 -1: ([B)Ljava/nio/ByteBuffer; +21 -1: twoToTheDoubleScaleUp +32 -1: sun/misc/URLClassPath$FileLoader +40 -1: (Ljava/util/List;Z)V +6 -1: cache1 +6 -1: cache2 +27 -1: Ljava/net/URLStreamHandler; +20 -1: Detect premature EOF +94 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)Lsun/nio/cs/StreamEncoder; +12 -1: NF_checkBase +20 -1: (Ljava/nio/Buffer;)V +45 -1: Ljava/util/Vector; +4 -1: Sync +12 -1: H_UNRESERVED +32 -1: (Ljava/util/Map;)Ljava/util/Set; +32 -1: (Ljava/util/Map$Entry;)Z +25 -1: java/util/Locale$Category +8 -1: receiver +9 -1: MAX_VALUE +4 -1: .RSA +25 -1: Ljava/net/URLClassLoader; +15 -1: Terminator.java +26 -1: (Ljava/lang/String;TV;)TV; +4 -1: null +76 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;)V +9 -1: checkCast +39 -1: ()Ljava/lang/AssertionStatusDirectives; +15 -1: declaredMethods +5 -1: clazz +21 -1: Retention policy: +20 -1: spreadArgElementType +9 -1: WORD_MASK +27 -1: ([IILjava/io/InputStream;)I +11 -1: getMethodAt +31 -1: (Ljava/net/URL;Ljava/net/URL;)Z +13 -1: getLocaleName +14 -1: isEnumConstant +41 -1: (Ljava/lang/String;)Ljava/nio/CharBuffer; +16 -1: newInvokeSpecial +26 -1: (Ljava/nio/ByteBuffer;IS)V +22 -1: sun/misc/JavaNioAccess +184 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/security/AccessControlContext; +96 -1: (Ljava/lang/invoke/MethodHandle;ILjava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle; +5 -1: ([S)I +30 -1: java/security/AccessController +37 -1: sun/misc/Launcher$SharedArchiveLoader +4 -1: pack +5 -1: ([S)V +51 -1: failure before throwing exception, dump stack +10 -1: dayOfMonth +6 -1: CENSIG +28 -1: java/util/function/Predicate +26 -1: Malformed \\uxxxx encoding. +9 -1: initIndex +11 -1: invoke_LL_L +23 -1: ConcurrentWeakInternSet +14 -1: java/lang/Void +42 -1: java/lang/String$CaseInsensitiveComparator +38 -1: Ljava/lang/invoke/LambdaForm$Compiled; +34 -1: java/util/Collections$SingletonSet +142 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Class;)Ljava/lang/invoke/CallSite; +35 -1: too many bootstrap method arguments +17 -1: maxDelimCodePoint +13 -1: previousIndex +3 -1: pop +6 -1: CENSIZ +7 -1: ([Z[Z)Z +11 -1: invoke_LL_V +3 -1: pos +33 -1: java/nio/file/WatchEvent$Modifier +3 -1: pow +12 -1: nextClearBit +15 -1: Dictionary.java +27 -1: sun/reflect/CallerSensitive +13 -1: signatureType +10 -1: dstSavings +13 -1: UnicodeLittle +16 -1: America/New_York +82 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;)Ljava/util/Locale; +25 -1: referenceKindIsConsistent +62 -1: Ljava/nio/Buffer;Ljava/lang/Comparable; +4 -1: INTS +11 -1: LOAD_FACTOR +40 -1: sun/reflect/DelegatingMethodAccessorImpl +16 -1: accumulateAndGet +21 -1: (B)Ljava/lang/String; +6 -1: UNSAFE +13 -1: resolveOrFail +21 -1: MapReduceMappingsTask +5 -1: arity +77 -1: (Ljava/io/FileDescriptor;ZZLjava/lang/Object;)Ljava/nio/channels/FileChannel; +5 -1: value +61 -1: Ljava/util/concurrent/ConcurrentHashMap$EntrySetView; +6 -1: forJar +52 -1: Ljava/lang/ref/Reference; +21 -1: CREATE_ACC_PERMISSION +28 -1: sun/misc/NativeSignalHandler +11 -1: defineClass +5 -1: match +93 -1: (Ljava/util/zip/ZipFile;Ljava/util/zip/ZipFile$ZipFileInputStream;Ljava/util/zip/Inflater;I)V +11 -1: Double.java +30 -1: America/Argentina/Buenos_Aires +8 -1: previous +37 -1: (Ljava/io/Writer;Ljava/lang/String;)V +9 -1: Synthetic +18 -1: isVMAnonymousClass +62 -1: ([Ljava/lang/Object;Ljava/lang/Object;Ljava/util/Comparator;)I +22 -1: (JI)Ljava/lang/String; +49 -1: (Ljava/lang/CharSequence;II)Ljava/io/PrintStream; +52 -1: ([Ljava/lang/Thread;)[[Ljava/lang/StackTraceElement; +12 -1: setDayOfWeek +11 -1: getManifest +30 -1: java/util/Locale$FilteringMode +54 -1: (Ljava/lang/String;)Lsun/util/calendar/CalendarSystem; +12 -1: nextHashCode +19 -1: ()Ljava/io/Console; +42 -1: AccessControlContext invoking the Combiner +19 -1: shouldBeInitialized +17 -1: invocationCounter +21 -1: IMPLEMENTATION_VENDOR +7 -1: chararr +60 -1: (Ljava/lang/String;)Ljava/util/Iterator; +11 -1: asCollector +52 -1: (ILjava/lang/CharSequence;)Ljava/lang/StringBuilder; +9 -1: exception +22 -1: newInstanceCallerCache +20 -1: nativeLibraryContext +24 -1: MODIFY_THREAD_PERMISSION +4 -1: WRAP +19 -1: Method name is null +32 -1: sun/invoke/util/ValueConversions +7 -1: APP_TAG +24 -1: (Ljava/util/Hashtable;)I +23 -1: METHOD_FORMAL_PARAMETER +18 -1: inflationThreshold +24 -1: java/io/DeleteOnExitHook +3 -1: pst +13 -1: BITS_PER_WORD +25 -1: getConstructorAnnotations +17 -1: CheckedCollection +24 -1: (Ljava/util/Hashtable;)V +7 -1: inClass +5 -1: getFD +8 -1: readLong +19 -1: aliases_ISO_8859_13 +19 -1: invokeWithArguments +19 -1: aliases_ISO_8859_15 +42 -1: ()Ljava/util/concurrent/ConcurrentHashMap; +8 -1: expandTo +23 -1: java/text/MessageFormat +8 -1: classID0 +11 -1: replaceWith +21 -1: Invalid port number : +65 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)V +19 -1: isGregorianLeapYear +16 -1: asSpreaderChecks +11 -1: withInitial +10 -1: X-UTF-32BE +57 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)V +12 -1: wrong type: +57 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Z +17 -1: sun/misc/Resource +14 -1: getReadTimeout +8 -1: safeTrim +38 -1: DIRECTIONALITY_RIGHT_TO_LEFT_EMBEDDING +14 -1: isElementIndex +23 -1: FilterOutputStream.java +6 -1: (IJI)V +3 -1: put +57 -1: (Ljava/lang/String;[Ljava/lang/Object;)Ljava/lang/String; +43 -1: Expecting an absolute path of the library: +8 -1: checkRef +53 -1: (Ljava/lang/String;)Ljava/lang/AbstractStringBuilder; +74 -1: (Ljava/lang/Class<*>;[Ljava/lang/reflect/Field;)[Ljava/lang/reflect/Field; +11 -1: user.script +10 -1: H_ALPHANUM +17 -1: getCalendarSystem +48 -1: Ljava/util/concurrent/ConcurrentHashMap; +17 -1: EnsureInitialized +82 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal;Ljava/lang/Object;)V +243 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsToIntTask;Ljava/util/function/ToIntBiFunction;ILjava/util/function/IntBinaryOperator;)V +26 -1: getAnnotatedExceptionTypes +10 -1: validIndex +6 -1: ([CC)I +8 -1: overflow +5 -1: getID +93 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)Lsun/nio/cs/StreamDecoder; +22 -1: java/util/StringJoiner +9 -1: putFields +18 -1: USE_SHARED_ARCHIVE +8 -1: thursday +8 -1: nanoTime +59 -1: (Lsun/reflect/annotation/AnnotationType;Ljava/lang/Class;)V +69 -1: (Ljava/nio/charset/CoderResult$Cache;I)Ljava/nio/charset/CoderResult; +36 -1: (J)Ljava/lang/AbstractStringBuilder; +16 -1: java/util/Arrays +6 -1: ([CC)V +25 -1: registerAsParallelCapable +4 -1: slot +24 -1: java/net/URLConnection$1 +6 -1: koi8-r +19 -1: should be of type +46 -1: java/util/concurrent/ConcurrentHashMap$TreeBin +6 -1: koi8-u +34 -1: data type scale not a power of two +53 -1: Ljava/util/Map; +21 -1: AccessibleObject.java +53 -1: ()Ljava/util/NavigableSet; +88 -1: (Ljava/util/List;Ljava/util/Collection;Ljava/util/Locale$FilteringMode;)Ljava/util/List; +17 -1: getAnnotationType +36 -1: Ljava/util/HashMap$TreeNode; +14 -1: declaringClass +10 -1: read,write +5 -1: getId +10 -1: BIG_ENDIAN +20 -1: PolymorphicSignature +16 -1: comparingByValue +67 -1: (ILjava/lang/invoke/MethodType;)[Ljava/lang/invoke/LambdaForm$Name; +19 -1: java/util/Hashtable +20 -1: getUnicodeLocaleKeys +27 -1: ()Ljava/util/LinkedHashMap; +51 -1: (Ljava/lang/CharSequence;)Ljava/lang/StringBuilder; +30 -1: java/util/HashMap$HashIterator +22 -1: (IZ)Ljava/lang/String; +5 -1: yield +34 -1: java/lang/Throwable$SentinelHolder +62 -1: (Ljava/lang/invoke/MethodType;ZI)Ljava/lang/invoke/LambdaForm; +5 -1: (FD)F +17 -1: java/util/SubList +24 -1: (Ljava/io/PrintStream;)V +7 -1: LF.zero +25 -1: java/util/StringTokenizer +15 -1: ISO8859_15_FDIS +11 -1: powerOfTwoD +11 -1: powerOfTwoF +22 -1: WeakHashMapSpliterator +15 -1: refKindIsGetter +12 -1: setRawOffset +11 -1: setProperty +23 -1: (Ljava/lang/Object;IB)V +45 -1: (ILjava/lang/Object;)Ljava/util/HashMap$Node; +13 -1: applyAsDouble +83 -1: (Lsun/misc/URLClassPath$FileLoader;Ljava/lang/String;Ljava/net/URL;Ljava/io/File;)V +19 -1: MethodAccessor.java +9 -1: WALL_TIME +7 -1: INVOKES +13 -1: java.ext.dirs +9 -1: getStatic +56 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/String; +42 -1: (Ljava/util/function/UnaryOperator;)V +27 -1: java/lang/Class$MethodArray +10 -1: H_USERINFO +19 -1: PostVMInitHook.java +7 -1: running +32 -1: Warning: passing argument as-is +13 -1: EntryIterator +22 -1: NF_checkSpreadArgument +46 -1: ([DLjava/util/function/IntToDoubleFunction;I)V +7 -1: . +13 -1: mappingLength +20 -1: implOnMalformedInput +53 -1: (Ljava/lang/String;ILjava/lang/reflect/Executable;I)V +26 -1: cannot make variable arity +18 -1: SharedSecrets.java +27 -1: (Ljava/io/InputStream;IZ)[B +9 -1: Asia/Gaza +55 -1: Ljava/util/Map;>; +5 -1: NTLM +19 -1: defaultCenturyStart +18 -1: addElapsedTimeFrom +38 -1: (Lsun/misc/Cleaner;)Lsun/misc/Cleaner; +44 -1: (Ljava/io/OutputStream;ZLjava/lang/String;)V +22 -1: (Ljava/lang/Object;B)V +6 1: [LBar; +7 -1: classes +23 -1: java/net/URLClassLoader +17 -1: sun/misc/Launcher +163 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$Node;)[Ljava/util/concurrent/ConcurrentHashMap$Node; +12 -1: updateAndGet +90 -1: (Ljava/net/URL;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;)V +9 -1: increment +27 -1: (Ljava/lang/CharSequence;)V +16 -1: Ljava/io/Reader; +27 -1: java/io/PushbackInputStream +6 -1: (JFZ)V +17 -1: getAppClassLoader +35 -1: sun/reflect/generics/tree/Signature +9 -1: elementAt +27 -1: (Ljava/lang/CharSequence;)Z +10 -1: readDouble +37 -1: ([B)Ljava/nio/charset/CharsetEncoder; +46 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;)V +4 -1: park +36 -1: java/lang/NegativeArraySizeException +49 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/Class;)Z +121 -1: ;>(Ljava/util/function/Function<-TT;+TU;>;)Ljava/util/Comparator; +101 -1: (Ljava/lang/annotation/Annotation;Ljava/lang/annotation/Annotation;)Ljava/lang/annotation/Annotation; +12 -1: .$|()[{^?*+\\ +6 -1: manRef +3 -1: 437 +15 -1: newStringUnsafe +15 -1: constantPoolOop +10 -1: getPackage +24 -1: FastCharsetProvider.java +18 -1: getAnnotationBytes +187 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class<*>;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/security/AccessControlContext; +33 -1: Cannot suppress a null exception. +27 -1: sun/nio/cs/StandardCharsets +33 -1: (BB)Ljava/lang/invoke/MemberName; +61 -1: ([Ljava/lang/ClassValue$Entry;ILjava/lang/ClassValue$Entry;)I +10 -1: X-UTF-32LE +5 -1: toMap +89 -1: (Ljava/lang/Class<*>;Ljava/util/List;>;)Ljava/lang/invoke/MethodType; +46 -1: ([Ljava/lang/Object;IILjava/util/Comparator;)V +66 -1: ([Ljava/lang/reflect/Constructor;)[Ljava/lang/reflect/Constructor; +22 -1: ()Ljava/nio/ByteOrder; +20 -1: isMethodHandleInvoke +25 -1: sun/net/www/URLConnection +89 -1: Ljava/util/concurrent/ConcurrentHashMap; +49 -1: (Ljava/nio/charset/Charset;FFLjava/lang/String;)V +17 -1: MIN_LOW_SURROGATE +23 -1: AbstractCollection.java +19 -1: (Ljava/util/Date;)I +19 -1: (Ljava/util/Date;)J +12 -1: cldrdata.jar +4 -1: path +77 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;IILjava/lang/String;[B)V +6 -1: MS1250 +37 -1: setJavaSecurityProtectionDomainAccess +11 -1: isDelimiter +5 -1: char0 +6 -1: MS1251 +5 -1: char1 +16 -1: getJavaNetAccess +6 -1: MS1252 +6 -1: MS1253 +6 -1: MS1254 +51 -1: (Ljava/lang/Class;)Ljava/security/ProtectionDomain; +6 -1: MS1257 +93 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/ProtectionDomain;)Ljava/lang/Class<*>; +10 -1: access$300 +5 -1: (JZ)C +19 -1: (Ljava/util/Date;)Z +5 -1: (JZ)D +26 -1: java/lang/Character$Subset +10 -1: access$302 +5 -1: (JZ)F +9 -1: emptyList +5 -1: (JZ)I +5 -1: (JZ)J +23 -1: (Ljava/lang/Runnable;)V +27 -1: java/lang/invoke/MemberName +29 -1: ()Ljava/util/Comparator; +18 -1: retrieveDirectives +7 -1: ([F[F)Z +40 -1: (Lsun/misc/URLClassPath;Ljava/net/URL;)V +5 -1: (JZ)S +40 -1: (Ljava/util/function/IntUnaryOperator;)I +5 -1: (JZ)V +16 -1: parseAnnotations +21 -1: (C)Ljava/lang/String; +73 -1: (TK;TV;)Ljava/util/Map; +15 -1: charset encoder +17 -1: getDomainCombiner +9 -1: EmptyList +15 -1: java.vm.version +19 -1: getResourceAsStream +94 -1: Ljava/lang/ThreadLocal;>; +26 -1: java/util/HashMap$TreeNode +22 -1: (Ljava/util/HashMap;)V +23 -1: sun/misc/URLClassPath$1 +65 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;)Ljava/net/URLClassLoader; +20 -1: Hashtable Enumerator +23 -1: sun/misc/URLClassPath$2 +10 -1: Array.java +8 -1: FT_LIMIT +24 -1: ()[Ljava/lang/Throwable; +23 -1: sun/misc/URLClassPath$3 +14 -1: java/io/Writer +5 -1: chars +76 -1: ()Ljava/util/NavigableMap; +6 -1: final +5 -1: error +34 -1: java/lang/ApplicationShutdownHooks +29 -1: Lsun/launcher/LauncherHelper; +30 -1: ()Ljava/util/Enumeration; +47 -1: (Ljava/util/List;)Ljava/lang/invoke/MethodType; +9 -1: scriptKey +5 -1: BYTES +12 -1: getException +69 -1: (Ljava/lang/Class<*>;Ljava/lang/Object;)Ljava/lang/invoke/MethodType; +14 -1: Illegal Load: +189 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$ReduceValuesTask;Ljava/util/function/BiFunction;)V +66 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsToLongTask +29 -1: getJavaIOFileDescriptorAccess +11 -1: toCodePoint +15 -1: setCreationTime +18 -1: NULL_CAUSE_MESSAGE +8 -1: elements +32 -1: ()Ljava/nio/charset/CoderResult; +8 -1: utf-32be +7 -1: addDate +4 -1: Cast +23 -1: sun/misc/JavaLangAccess +8 -1: 0{1,12}$ +27 -1: (Ljava/util/ArrayList;III)V +11 -1: lastIndexOf +14 -1: getCodeSources +53 -1: (Lsun/util/calendar/CalendarDate;Ljava/lang/String;)V +17 -1: cachedConstructor +7 -1: forName +74 -1: (Ljava/util/function/ToLongFunction;Ljava/lang/Object;Ljava/lang/Object;)I +47 -1: (Ljava/lang/Object;)Lsun/reflect/FieldAccessor; +8 -1: getDebug +18 -1: currentClassLoader +49 -1: Illegal leading minus sign on unsigned string %s. +20 -1: toLowerCaseCharArray +38 -1: java/util/concurrent/ConcurrentHashMap +8 -1: isHidden +92 -1: (Ljava/lang/Thread;ILjava/lang/Object;Ljava/lang/Thread;JJJJ[Ljava/lang/StackTraceElement;)V +29 -1: java/lang/ArithmeticException +26 -1: (Ljava/io/OutputStream;Z)V +66 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/RuntimeException; +38 -1: Ljava/util/Map; +16 -1: getFindClassTime +34 -1: ([J)Ljava/util/Spliterator$OfLong; +24 -1: UnmodifiableNavigableSet +32 -1: java/lang/ClassNotFoundException +3 -1: \\n +6 -1: SEALED +14 -1: Flushable.java +3 -1: HST +24 -1: (Ljava/lang/Object;JII)Z +13 -1: toSecondOfDay +16 -1: thenComparingInt +26 -1: java/lang/NoSuchFieldError +18 -1: java/util/Locale$1 +25 -1: [Ljava/util/HashMap$Node; +75 -1: ([Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/lang/String; +11 -1: x-mswin-936 +32 -1: java/lang/management/MemoryUsage +25 -1: (JS)Ljava/nio/ByteBuffer; +25 -1: java/lang/ref/Finalizer$1 +25 -1: java/lang/ref/Finalizer$2 +21 -1: (Ljava/util/BitSet;)V +25 -1: java/lang/ref/Finalizer$3 +83 -1: (Ljava/util/Collection<+TT;>;Ljava/util/Comparator<-TT;>;)TT; +24 -1: sun/nio/ch/Interruptible +21 -1: (Ljava/util/BitSet;)Z +72 -1: ([Ljava/security/ProtectionDomain;Ljava/security/AccessControlContext;)V +54 -1: Ljava/util/AbstractSet;>; +34 -1: getConstructorParameterAnnotations +4 -1: name +92 -1: ;>Ljava/lang/Object;Ljava/lang/Comparable;Ljava/io/Serializable; +11 -1: FORM_OFFSET +13 -1: getAliasTable +5 -1: (DD)D +23 -1: reflectionFactoryAccess +221 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesTask;Ljava/util/function/Function;Ljava/util/function/BiFunction;)V +59 -1: (Ljava/lang/String;[Ljava/lang/String;)Ljava/nio/file/Path; +6 -1: DELETE +10 -1: returnType +5 -1: (DD)I +51 -1: ()Lsun/reflect/generics/repository/FieldRepository; +8 -1: delegate +12 -1: OTHER_LETTER +18 -1: getTransitionIndex +3 -1: HUP +10 -1: (IIII[CI)V +10 -1: ISO_8859-1 +17 -1: ArrayEncoder.java +10 -1: ISO_8859-2 +34 -1: java/lang/reflect/AnnotatedElement +10 -1: ISO_8859-4 +27 -1: sun/nio/cs/UTF_16LE$Decoder +10 -1: ISO_8859-5 +13 -1: prefetchWrite +9 -1: getFloatB +10 -1: ISO_8859-7 +37 -1: (I)Ljava/lang/invoke/LambdaForm$Name; +10 -1: ISO_8859-9 +10 -1: getActions +11 -1: negateExact +10 -1: isAbstract +9 -1: getFloatL +29 -1: java/lang/ClassValue$Identity +14 -1: java/io/Reader +8 -1: getOwner +24 -1: java/lang/AssertionError +17 -1: MethodHandle.java +19 -1: classRedefinedCount +10 -1: cachedYear +15 -1: getAndIncrement +26 -1: java.protocol.handler.pkgs +14 -1: cleanSomeSlots +27 -1: java/util/Spliterator$OfInt +31 -1: getRawExecutableTypeAnnotations +20 -1: ensureInitialization +7 -1: os.arch +57 -1: (Ljava/security/cert/CertPath;Ljava/security/Timestamp;)V +21 -1: UNSAFE_COPY_THRESHOLD +20 -1: toUnsignedBigInteger +82 -1: (Ljava/util/concurrent/locks/Condition;)Ljava/util/Collection; +15 -1: Reflection.java +12 -1: decryptBlock +3 -1: \\r +8 -1: newArray +8 -1: Category +36 -1: java/lang/reflect/GenericDeclaration +22 -1: (Ljava/lang/String;Z)V +8 -1: suspend0 +10 -1: getSigners +22 -1: (Ljava/lang/String;Z)Z +31 -1: Unable to create temporary file +117 -1: (Ljava/lang/ClassValue;Ljava/lang/ClassValue$Entry;)Ljava/lang/ClassValue$Entry; +17 -1: channelsAvailable +9 -1: Date.java +13 -1: toIndex < 0: +18 -1: mark > position: ( +11 -1: loadConvert +4 -1: july +42 -1: (Ljava/math/BigInteger;)Ljava/lang/String; +6 -1: enable +47 -1: (Ljava/util/zip/ZipEntry;)Ljava/io/InputStream; +6 -1: unpack +13 -1: setDayOfMonth +19 -1: name can't be empty +16 -1: getExtensionKeys +15 -1: getAndDecrement +36 -1: Ljava/lang/ClassValue$ClassValueMap; +38 -1: (Ljava/lang/Class;Ljava/lang/String;)V +11 -1: csISOlatin0 +9 -1: retention +23 -1: system protocol handler +9 -1: nullsLast +15 -1: refKindIsStatic +3 -1: (\n +48 -1: sun/launcher/LauncherHelper$ResourceBundleHolder +29 -1: ()Ljava/util/LinkedList; +11 -1: csISOlatin9 +31 -1: ([CII)Ljava/lang/StringBuilder; +29 -1: (II)Ljava/lang/StringBuilder; +7 -1: pdcache +4 -1: june +12 -1: ;/?:@&=+$,[] +141 -1: ([Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;)[Ljava/lang/invoke/LambdaForm$Name; +32 -1: ()[Ljava/util/WeakHashMap$Entry; +110 -1: (Ljava/lang/Class<*>;ILjava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle; +81 -1: (Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z +46 -1: String value %s exceeds range of unsigned int. +6 -1: close0 +6 -1: (JDZ)V +160 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/reflect/GenericDeclaration;Ljava/lang/reflect/Type;Ljava/lang/reflect/AnnotatedElement; +12 -1: LinkedValues +24 -1: java/nio/HeapCharBufferR +23 -1: jvmVersionInfoAvailable +16 -1: classLoaderDepth +33 -1: (Lsun/nio/ch/DirectBuffer;IIIII)V +32 -1: java/nio/file/attribute/FileTime +50 -1: java/util/concurrent/ConcurrentHashMap$CounterCell +73 -1: (Lsun/misc/URLClassPath$JarLoader;Lsun/misc/JarIndex;)Lsun/misc/JarIndex; +60 -1: (Ljava/net/URL;Ljava/lang/String;)Ljava/security/CodeSource; +25 -1: Ljava/lang/ref/Finalizer; +12 -1: utf-32be-bom +40 -1: (Ljava/lang/String;ILjava/lang/Object;)V +9 -1: THROW_UCS +23 -1: java/util/AbstractMap$1 +23 -1: java/util/AbstractMap$2 +10 -1: x-utf-32be +4 -1: (S)B +60 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/LambdaForm; +20 -1: ResourceBundleHolder +4 -1: (S)I +13 -1: getSuppressed +17 -1: jdk_micro_version +4 -1: (S)J +9 -1: isNumeric +10 -1: variantKey +8 -1: utf-32le +47 -1: java/util/concurrent/ConcurrentHashMap$MapEntry +25 -1: ()Ljava/lang/Class<-TT;>; +6 -1: closed +4 -1: (S)S +15 -1: setStandardTime +10 -1: ShortCache +4 -1: (S)V +40 -1: sun/net/www/MessageHeader$HeaderIterator +17 -1: jdk_major_version +8 -1: FXHelper +6 -1: CENTIM +19 -1: java/security/Guard +46 -1: java.lang.invoke.MethodHandle.DUMP_CLASS_FILES +4 -1: ENUM +27 -1: Ljava/lang/SecurityManager; +39 -1: ([Ljava/lang/Class;[Ljava/lang/Class;)Z +11 -1: getFieldAt0 +12 -1: user.variant +28 -1: (Ljava/io/DataInputStream;)V +44 -1: ([JLjava/util/function/LongBinaryOperator;)V +7 -1: getRoot +3 -1: + +16 -1: identityHashCode +25 -1: java/security/Permissions +16 -1: Ljava/net/Proxy; +23 -1: java/io/ExpiringCache$1 +5 -1: more +10 -1: formatList +49 -1: (Ljava/lang/String;)Lsun/launcher/LauncherHelper; +29 -1: Relative path in absolute URI +11 -1: checkMapped +8 -1: Checksum +8 -1: " Radix: +9 -1: getAndAdd +9 -1: implReady +16 -1: SynchronizedList +30 -1: [Ljava/lang/StackTraceElement; +5 -1: right +13 -1: UTF_16BE.java +4 -1: HEAD +11 -1: isInvocable +6 -1: ENDCOM +15 -1: getPropertiesEx +6 -1: Unsafe +7 -1: IBM-819 +37 -1: : 0 <= i2 && i2 < names.length: 0 <= +19 -1: filterAndAddHeaders +22 -1: nativeParkEventPointer +18 -1: checkPositionIndex +13 -1: invalid url: +25 -1: out of range from input +9 -1: loadClass +12 -1: encodingName +9 -1: x-JIS0208 +38 -1: (Ljava/lang/Class;Ljava/lang/Object;)Z +28 -1: (I)Ljava/lang/reflect/Field; +17 -1: getJvmVersionInfo +6 -1: LIJFDV +21 -1: (D)Ljava/lang/String; +7 -1: oomeMsg +30 -1: java/io/InvalidObjectException +25 -1: java/io/FilterInputStream +32 -1: Ljava/net/ContentHandlerFactory; +13 -1: toUnsignedInt +17 -1: reconstitutionPut +37 -1: (Ljava/lang/Object;)Ljava/lang/Class; +14 -1: getContentType +43 -1: java/util/Collections$SynchronizedSortedSet +24 -1: (II)Ljava/nio/file/Path; +25 -1: JAVAFX_APPLICATION_MARKER +29 -1: (IC)Ljava/lang/StringBuilder; +13 -1: java/util/Set +10 -1: clearError +64 -1: (Ljava/lang/invoke/MethodType;[I)Ljava/lang/invoke/MethodHandle; +25 -1: java/io/FileInputStream$1 +8 -1: getFirst +36 -1: (Lsun/reflect/ConstructorAccessor;)V +84 -1: (Ljava/util/NavigableMap;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/NavigableMap; +42 -1: (Ljava/lang/CharSequence;)Ljava/io/Writer; +52 -1: ([Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType; +6 -1: (IFI)V +62 -1: Ljava/lang/Object;Ljava/util/Queue; +17 -1: getHeaderFieldInt +16 -1: CheckedSortedMap +39 -1: (ZILjava/lang/String;)Ljava/lang/Class; +10 -1: getterName +10 -1: Asia/Tokyo +4 -1: Node +7 -1: rotate1 +13 -1: Stream closed +7 -1: rotate2 +9 -1: checkExec +17 -1: NF_checkExactType +18 -1: ReverseComparator2 +18 -1: arrayElementGetter +97 -1: (Ljava/util/ArrayPrefixHelpers$DoubleCumulateTask;Ljava/util/function/DoubleBinaryOperator;[DII)V +9 -1: iso8859-1 +9 -1: iso8859-2 +9 -1: iso8859-4 +9 -1: iso8859-5 +9 -1: iso8859-7 +16 -1: getPermissions +9 -1: iso8859-9 +9 -1: fromClass +17 -1: with modifiers " +8 -1: isBooted +24 -1: getCommonPoolParallelism +10 -1: initialize +47 -1: (TT;)Ljava/util/Set; +17 -1: checkElementIndex +14 -1: openConnection +47 -1: (Ljava/lang/Thread;Lsun/nio/ch/Interruptible;)V +12 -1: isAuthorized +17 -1: ReduceEntriesTask +7 -1: command +24 -1: ArithmeticException.java +24 -1: ensureOpenOrZipException +67 -1: (Lsun/util/calendar/CalendarDate;I)Lsun/util/calendar/CalendarDate; +39 -1: Ljava/lang/invoke/MethodHandles$Lookup; +31 -1: Enclosing constructor not found +34 -1: ()Lsun/util/calendar/BaseCalendar; +25 -1: (JLjava/lang/Object;JJJ)V +12 -1: > toIndex: +22 -1: LocaleObjectCache.java +19 -1: sun/misc/Launcher$1 +31 -1: java/util/HashMap$EntryIterator +8 -1: contains +60 -1: Ljava/lang/Object; +53 -1: (I[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType; +19 -1: java/io/PrintStream +42 -1: java/lang/Math$RandomNumberGeneratorHolder +100 -1: (I)Ljava/util/concurrent/ConcurrentHashMap$KeySetView; +14 -1: getCapturedArg +14 -1: getCodeSigners +20 -1: mark() not supported +56 -1: (Lsun/misc/URLClassPath;I)Lsun/misc/URLClassPath$Loader; +20 -1: java/lang/StrictMath +14 -1: annotationType +3 -1: IET +4 -1: lang +13 -1: JarEntry.java +9 -1: ([CIIII)I +9 -1: canEncode +5 -1: extra +30 -1: java/lang/ref/ReferenceQueue$1 +37 -1: java/nio/channels/ReadableByteChannel +73 -1: (Ljava/util/Map$Entry;)Z +24 -1: java/io/BufferedReader$1 +10 -1: x-utf-32le +16 -1: methodDescriptor +25 -1: (IJ)Ljava/nio/ByteBuffer; +18 -1: getSystemResources +46 -1: (Ljava/lang/String;I)Ljava/util/regex/Pattern; +46 -1: (Ljava/net/URL;)Lsun/misc/URLClassPath$Loader; +20 -1: calendars.properties +25 -1: implOnUnmappableCharacter +12 -1: signers_name +40 -1: (ZILjava/util/Locale;)Ljava/lang/String; +8 -1: (TE;)TE; +50 -1: ()Lsun/util/locale/provider/LocaleProviderAdapter; +11 -1: key is null +7 -1: encrypt +21 -1: millisUntilExpiration +55 -1: Unable to parse property sun.reflect.inflationThreshold +9 -1: checkExit +5 -1: SHORT +43 -1: java/util/Collections$UnmodifiableSortedSet +10 -1: ISO8859_15 +16 -1: verifyParameters +24 -1: buildAnnotatedInterfaces +15 -1: refKindIsSetter +45 -1: (JLjava/util/function/BiConsumer<-TK;-TV;>;)V +23 -1: (Ljava/lang/Object;IC)V +90 -1: (Ljava/lang/ClassValue$Entry;)Ljava/lang/ClassValue$Entry; +30 -1: (Ljava/net/URL;)Ljava/net/URI; +60 -1: (BLjava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;)V +43 -1: (Ljava/util/Collection;Ljava/lang/Object;)I +44 -1: (Ljava/net/URLConnection;)Ljava/lang/Object; +17 -1: Stream not marked +11 -1: targetCheck +127 -1: (Ljava/lang/Class<*>;ILjava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName; +11 -1: debugString +112 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle; +43 -1: (Ljava/util/Collection;Ljava/lang/Object;)V +15 -1: NF_staticOffset +22 -1: CASE_INSENSITIVE_ORDER +6 -1: unpark +29 -1: (Ljava/lang/CharSequence;II)I +59 -1: Ljava/util/concurrent/ConcurrentHashMap$KeySetView; +19 -1: defaultFormatLocale +7 -1: combine +58 -1: (Ljava/util/Locale$LocaleKey;)Lsun/util/locale/BaseLocale; +29 -1: (Ljava/lang/CharSequence;II)V +35 -1: sun/util/calendar/BaseCalendar$Date +57 -1: Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater; +75 -1: ([Ljava/lang/reflect/Member;[Ljava/lang/String;)[Ljava/lang/reflect/Member; +15 -1: MethodType_init +5 -1: (JF)V +20 -1: AUTOSELECT_FILTERING +12 -1: invokeStatic +18 -1: readFileDescriptor +22 -1: java/lang/Terminator$1 +72 -1: (Ljava/lang/Object;Ljava/util/function/UnaryOperator;)Ljava/lang/Object; +17 -1: EMPTY_STACK_TRACE +13 -1: isSamePackage +32 -1: ()Ljava/security/DomainCombiner; +10 -1: decodeLoop +30 -1: DIRECTIONALITY_EUROPEAN_NUMBER +112 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/lang/String; +33 -1: (Ljava/util/function/Predicate;)Z +35 -1: logincontext login context results +17 -1: sun/nio/cs/UTF_16 +13 -1: SingletonList +5 -1: end= +7 -1: getURLs +17 -1: traceInstructions +22 -1: generateCustomizedCode +9 -1: NO_CHANGE +11 -1: Number.java +49 -1: (ITT;)Ljava/util/List; +19 -1: checkSpecifyHandler +8 -1: setValue +30 -1: (Ljava/net/URL;)Ljava/net/URL; +22 -1: (Ljava/lang/Object;C)V +19 -1: Negative capacity: +24 -1: ArrayStoreException.java +52 -1: (Ljava/lang/StringBuffer;II)Ljava/lang/StringBuffer; +14 -1: linkMethodImpl +42 -1: java/util/InvalidPropertiesFormatException +4 -1: last +19 -1: getLocalizedMessage +65 -1: (Ljava/text/MessageFormat;[Ljava/lang/String;)[Ljava/lang/String; +61 -1: Ljava/lang/Object;Ljava/util/Enumeration; +40 -1: (I[CII)Ljava/lang/AbstractStringBuilder; +27 -1: java.launcher.opt.datamodel +29 -1: (Ljava/lang/reflect/Method;)V +19 -1: SPECIFICATION_TITLE +123 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;ILjava/lang/Class;)Lsun/reflect/SerializationConstructorAccessorImpl; +32 -1: (I[CII)Ljava/lang/StringBuilder; +29 -1: (Ljava/lang/reflect/Method;)Z +23 -1: (Z[B)Ljava/lang/String; +27 -1: sun/nio/cs/Surrogate$Parser +32 -1: (Ljavax/security/auth/Subject;)Z +29 -1: ()Ljava/lang/invoke/Invokers; +7 -1: getPool +7 -1: textOut +12 -1: getEntryTime +14 -1: classModifiers +47 -1: (Ljava/util/Locale$Category;)Ljava/util/Locale; +32 -1: getInheritedAccessControlContext +4 -1: rcbt +37 -1: (Ljava/lang/Class<*>;Ljava/io/File;)Z +25 -1: AccessControlContext.java +22 -1: FileURLConnection.java +12 -1: NaturalOrder +34 -1: sun/util/calendar/CalendarSystem$1 +94 -1: ([Ljava/lang/reflect/Method;Ljava/lang/String;[Ljava/lang/Class<*>;)Ljava/lang/reflect/Method; +17 -1: No enum constant +7 -1: ([DII)V +8 -1: register +23 -1: FINAL_QUOTE_PUNCTUATION +27 -1: ACCESS_CLIPBOARD_PERMISSION +15 -1: verifyConstants +20 -1: (Ljava/io/Writer;I)V +45 -1: (Ljava/lang/String;)Ljava/lang/reflect/Field; +24 -1: linkMethodHandleConstant +43 -1: (Ljava/io/OutputStream;Ljava/lang/String;)V +125 -1: (Ljava/util/Comparator<-TV;>;)Ljava/util/Comparator;>; +14 -1: ALL_PERMISSION +12 -1: createObject +10 -1: CRC32.java +14 -1: reservedMemory +22 -1: ensureCapacityInternal +11 -1: FormatData_ +9 -1: maxMemory +27 -1: (I)Ljava/util/ListIterator; +8 -1: UTF-16BE +27 -1: AbstractSequentialList.java +10 -1: access$400 +16 -1: Locale settings: +10 -1: access$402 +12 -1: HashSet.java +24 -1: java/lang/Long$LongCache +30 -1: [Ljava/lang/reflect/Parameter; +11 -1: single_step +45 -1: (Ljava/lang/String;)Lsun/security/util/Debug; +97 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;)Ljava/lang/invoke/SimpleMethodHandle; +16 -1: indexOfBangSlash +7 -1: region= +26 -1: ([BII)Ljava/lang/Class<*>; +8 -1: bitCount +3 -1: INT +67 -1: ([TT;Ljava/util/function/IntFunction<+TT;>;)V +35 -1: newGetFloatIllegalArgumentException +11 -1: ([DII[DII)V +22 -1: makePreparedLambdaForm +3 -1: < +35 -1: sun/management/GarbageCollectorImpl +4 -1: (*)* +7 -1: getPort +18 -1: java/io/FileSystem +7 -1: getNode +38 -1: (Ljava/lang/Object;I)Ljava/lang/Class; +36 -1: $SwitchMap$java$util$Locale$Category +18 -1: securityCheckCache +5 -1: cdate +10 -1: childValue +19 -1: getMainClassFromJar +70 -1: ;>(Ljava/lang/Class;Ljava/lang/String;)TT; +20 -1: unsuspendSomeThreads +29 -1: sun.classloader.findClassTime +11 -1: plusSeconds +3 -1: = +4 -1: Lock +7 -1: regions +38 -1: ()Ljava/lang/reflect/Constructor; +25 -1: parseParameterAnnotations +20 -1: getSystemGMTOffsetID +33 -1: [Cc][Oo][Dd][Ee][Bb][Aa][Ss][Ee]= +37 -1: (Ljava/lang/String;I)Ljava/lang/Byte; +10 -1: permission +78 -1: (Ljava/lang/reflect/Constructor;)Lsun/reflect/generics/scope/ConstructorScope; +28 -1: (Lsun/misc/JavaLangAccess;)V +26 -1: GET_CLASSLOADER_PERMISSION +24 -1: (J)Ljava/nio/ByteBuffer; +20 -1: getUnresolvedActions +49 -1: (I[BIILsun/security/util/ManifestEntryVerifier;)V +5 -1: (ZJ)V +14 -1: isClassOnlyJar +35 -1: ()[Ljava/util/HashMap$Node; +23 -1: ()Ljava/util/SortedMap; +29 -1: HistoricallyNamedCharset.java +30 -1: no leading reference parameter +8 -1: csCESU-8 +3 -1: > +13 -1: invoke_LLLL_L +109 -1: (Ljava/util/NavigableMap;)Ljava/util/NavigableMap; +13 -1: invoke_LLLL_V +46 -1: (Ljava/lang/Class;Z)[Ljava/lang/reflect/Field; +5 -1: offer +12 -1: isoLanguages +61 -1: (Ljava/io/OutputStream;Ljava/lang/String;Ljava/lang/String;)V +44 -1: sun/reflect/BootstrapConstructorAccessorImpl +12 -1: BaseIterator +58 -1: (IZ[Ljava/lang/Class;[Ljava/lang/Class;)Ljava/lang/String; +23 -1: initializeOSEnvironment +62 -1: ([Ljava/security/cert/Certificate;)[Ljava/security/CodeSigner; +3 -1: >> +13 -1: searchEntries +7 -1: setDate +3 -1: red +3 -1: ref +10 -1: EMPTY_LIST +3 -1: rem +78 -1: Ljava/util/AbstractCollection;Ljava/util/List; +9 -1: scanToken +6 -1: greek8 +9 -1: basicType +12 -1: getFromClass +43 -1: averageCharsPerByte exceeds maxCharsPerByte +8 -1: isDaemon +7 -1: nonNull +17 -1: Invalid default: +45 -1: (Lsun/misc/URLClassPath;Ljava/lang/String;Z)V +18 -1: java/lang/String$1 +11 -1: copyMethods +15 -1: sun/misc/Signal +5 -1: float +18 -1: StreamDecoder.java +19 -1: no such constructor +14 -1: bad arity for +14 -1: divideUnsigned +10 -1: CODING_END +3 -1: IST +14 -1: HeaderIterator +9 -1: september +20 -1: makeVarargsCollector +6 -1: L_PATH +45 -1: (Ljava/lang/String;)Ljava/io/File$PathStatus; +24 -1: URI scheme is not "file" +85 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class<*>;)V +27 -1: java/util/function/Supplier +17 -1: checkedCollection +8 -1: MapEntry +81 -1: (Ljava/lang/invoke/MethodHandle;ILjava/util/List;)Ljava/lang/invoke/MethodHandle; +34 -1: java/security/ProtectionDomain$Key +14 -1: List length = +39 -1: ([Ljava/lang/Object;)Ljava/lang/String; +87 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/function/BiFunction;)Ljava/lang/Object; +7 -1: unparse +28 -1: jarFileHasClassPathAttribute +40 -1: (Lsun/misc/JavaIOFileDescriptorAccess;)V +30 -1: (Ljava/lang/reflect/Field;ZZ)V +22 -1: GetPropertyAction.java +8 -1: RUNNABLE +10 -1: exprString +13 -1: getAnnotation +19 -1: class can't be null +22 -1: defaultAssertionStatus +8 -1: getName0 +16 -1: quoteReplacement +15 -1: getMemberVMInfo +42 -1: (Ljava/lang/Class<*>;)Ljava/lang/Class<*>; +16 -1: cachedLambdaForm +16 -1: addFinalRefCount +12 -1: getMethodAt0 +8 -1: ([ZII)[Z +44 -1: (Ljava/lang/Object;TV;Ljava/lang/Object;)TV; +4 -1: [TT; +29 -1: Ljava/lang/invoke/LambdaForm; +28 -1: java/util/DualPivotQuicksort +61 -1: ()Ljava/util/concurrent/ConcurrentHashMap$KeySetView; +17 -1: registerDirectory +8 -1: jarFiles +69 -1: (Ljava/lang/CharSequence;[Ljava/lang/CharSequence;)Ljava/lang/String; +54 -1: [Ljava/util/concurrent/ConcurrentHashMap$Node; +15 -1: getDefaultValue +39 -1: sun/util/calendar/ZoneInfoFile$Checksum +20 -1: DISABLE_JAR_CHECKING +12 -1: CONTENT_TYPE +46 -1: array type not assignable to trailing argument +60 -1: ([TT;II)Ljava/util/stream/Stream; +47 -1: java.lang.invoke.MethodHandle.COMPILE_THRESHOLD +9 -1: toInstant +152 -1: (Ljava/util/NavigableMap;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/NavigableMap; +7 -1: L_ALPHA +29 -1: java/lang/AbstractMethodError +29 -1: java/util/jar/Attributes$Name +15 -1: LOCALE_SETTINGS +19 -1: (J)Ljava/lang/Long; +4 -1: jar: +17 -1: ensureInitialized +13 -1: LAST_MODIFIED +40 -1: ([Ljava/lang/String;)[Ljava/lang/String; +7 -1: shuffle +70 -1: (Lsun/util/locale/LanguageTag;)Lsun/util/locale/InternalLocaleBuilder; +19 -1: isPackageAccessible +17 -1: compileToBytecode +11 -1: getPackages +237 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysToIntTask;Ljava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)V +53 -1: java/util/concurrent/ConcurrentHashMap$KeySpliterator +26 -1: setURLStreamHandlerFactory +47 -1: access print all checkPermission results +22 -1: sun/reflect/MethodInfo +75 -1: (Ljava/lang/String;ZLjava/util/Set;)Lsun/misc/Resource; +6 -1: KOI8-R +14 -1: Character.java +5 -1: (SS)I +8 -1: unshared +73 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;)Ljava/lang/Class; +19 -1: replacementTreeNode +10 -1: BA_REGULAR +8 -1: UTF-16LE +44 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)V +22 -1: InputStreamReader.java +17 -1: getInvocationType +23 -1: getDeclaredConstructors +48 -1: [Lsun/reflect/generics/tree/FormalTypeParameter; +67 -1: (Ljava/util/Comparator;Ljava/util/Map$Entry;Ljava/util/Map$Entry;)I +6 -1: koi8_r +14 -1: ofTotalSeconds +16 -1: content-encoding +6 -1: koi8_u +10 -1: getEncoded +6 -1: ()[TT; +43 -1: ([ILjava/util/function/IntUnaryOperator;I)V +18 -1: getSecurityContext +13 -1: LF_GEN_LINKER +78 -1: (BLjava/lang/invoke/MemberName;Ljava/lang/Class;)Ljava/lang/invoke/MemberName; +49 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;II)V +19 -1: LinkedEntryIterator +23 -1: Warning: JIT compiler " +7 -1: static +100 -1: (Ljava/lang/Class;ZLjava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Class;)Ljava/util/List; +79 -1: (Ljava/util/Collection<+TT;>;)Ljava/util/Collection; +10 -1: iso-ir-100 +10 -1: iso-ir-101 +13 -1: toUpperString +31 -1: ()Ljava/util/Spliterator$OfInt; +43 -1: Ljava/lang/StringIndexOutOfBoundsException; +19 -1: Lsun/misc/JarIndex; +7 -1: Version +90 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/ProtectionDomain;)Ljava/lang/Class; +10 -1: getHandler +45 -1: (ILjava/lang/Object;)Ljava/lang/StringBuffer; +28 -1: getDeclaredAnnotationsByType +46 -1: ([Ljava/lang/Class;Ljava/lang/StringBuilder;)V +53 -1: ()Ljava/util/Enumeration; +15 -1: addAllNonStatic +10 -1: iso-ir-110 +14 -1: Using VM: +17 -1: casReflectionData +26 -1: (Lsun/util/PreHashedMap;)I +24 -1: removeByNameAndSignature +4 -1: OS X +85 -1: (Ljava/lang/ClassLoader;Ljava/lang/String;Ljava/lang/ClassLoader;Ljava/lang/String;)Z +16 -1: JarEntryIterator +38 -1: Ljava/lang/Class; +37 -1: Ljava/lang/Class; +28 -1: ([Ljava/util/HashMap$Node;)V +34 -1: java/lang/reflect/GenericArrayType +14 -1: annotationData +26 -1: (Lsun/util/PreHashedMap;)V +22 -1: checkPackageDefinition +30 -1: ACCUMULATED_DAYS_IN_MONTH_LEAP +12 -1: lowestOneBit +64 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal;)V +16 -1: asReadOnlyBuffer +11 -1: getRealName +17 -1: StringCoding.java +10 -1: iso-ir-126 +11 -1: isSurrogate +8 -1: setError +138 -1: (Ljava/util/function/Function<-TT;+TU;>;Ljava/util/Comparator<-TU;>;)Ljava/util/Comparator; +8 -1: (TK;)TK; +4 -1: java +136 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;)TT; +36 -1: ()Lsun/util/locale/LocaleExtensions; +12 -1: doubleStream +28 -1: ()Ljava/util/SimpleTimeZone; +7 -1: :@&=+$, +94 -1: Ljava/lang/ThreadLocal;>; +64 -1: (Ljava/lang/String;[Ljava/lang/Class;)Ljava/lang/reflect/Method; +19 -1: getSystemTimeZoneID +18 -1: ReentrantLock.java +8 -1: emptyMap +16 -1: getSavedProperty +249 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesToDoubleTask;Ljava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)V +14 -1: KeySpliterator +13 -1: findResources +14 -1: forWrapperType +8 -1: floorMod +12 -1: isoCountries +10 -1: CheckedSet +21 -1: AbstractCalendar.java +12 -1: IS_INVOCABLE +45 -1: (Ljava/lang/Class;)Lsun/reflect/ConstantPool; +19 -1: checkSecurityAccess +13 -1: Invalid index +28 -1: STACK_TRACE_ELEMENT_SENTINEL +88 -1: (ILjava/lang/Object;Ljava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$TreeNode; +130 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V +14 -1: aliases_IBM437 +10 -1: iso-ir-144 +10 -1: iso-ir-148 +35 -1: ()Ljava/nio/charset/CharsetDecoder; +95 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle; +16 -1: UnmodifiableList +40 -1: ()Ljava/util/concurrent/locks/Condition; +9 -1: Path.java +80 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;[Ljava/lang/Class;)Ljava/util/Map; +36 -1: Ljava/lang/Class; +124 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;)Ljava/lang/Object; +20 -1: privateGetParameters +24 -1: sun/nio/cs/StreamDecoder +12 -1: getFreeSpace +8 -1: US-ASCII +22 -1: negativeZeroDoubleBits +9 -1: putObject +13 -1: linkToVirtual +35 -1: Ljava/lang/Class; +15 -1: detectedCharset +26 -1: java/lang/reflect/Modifier +22 -1: JAVAFX_LAUNCH_MODE_JAR +32 -1: java/net/URLStreamHandlerFactory +7 -1: IBM-923 +80 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/String; +13 -1: TRANSFERINDEX +34 -1: (Lsun/nio/cs/StandardCharsets$1;)V +23 -1: ()Ljava/io/InputStream; +16 -1: ()Ljava/io/File; +41 -1: (Ljava/lang/String;)Ljava/nio/ByteBuffer; +22 -1: sun/reflect/Reflection +23 -1: java/lang/AutoCloseable +25 -1: BootstrapMethodError.java +19 -1: EnclosingMethodInfo +13 -1: transferIndex +18 -1: java/lang/Compiler +4 -1: zero +29 -1: java/util/Arrays$NaturalOrder +9 -1: language= +37 -1: Ljava/util/ArrayList; +73 -1: ()Ljava/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject; +16 -1: balanceInsertion +82 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;I)V +11 -1: asIntBuffer +27 -1: (Ljava/util/LinkedList;II)V +13 -1: ofEpochSecond +19 -1: sunjce_provider.jar +21 -1: (F)Ljava/lang/String; +32 -1: >> does not contain binding << +21 -1: declaredPublicMethods +5 -1: FIELD +17 -1: getPrimitiveClass +127 -1: (Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl;Ljava/lang/Class;Ljava/lang/String;)V +21 -1: replaceParameterTypes +73 -1: Ljava/util/Map;Ljava/security/PermissionCollection;>; +21 -1: (Ljava/lang/Double;)I +5 -1: floor +4 -1: halt +14 -1: newConstructor +48 -1: (Ljava/util/function/BiFunction<-TK;-TV;+TV;>;)V +17 -1: packageAccessLock +15 -1: America/Phoenix +19 -1: Incoming arguments: +11 -1: V_Monotonic +14 -1: decrementExact +15 -1: updatePositions +14 -1: toLocaleString +12 -1: appendEscape +7 -1: DISPLAY +27 -1: sun/nio/cs/US_ASCII$Decoder +13 -1: LITTLE_ENDIAN +6 -1: isNull +13 -1: TempDirectory +6 -1: LM_JAR +39 -1: JVMTI_THREAD_STATE_WAITING_WITH_TIMEOUT +10 -1: isCompiled +36 -1: (Ljava/lang/AbstractStringBuilder;)Z +3 -1: run +17 -1: START_PUNCTUATION +33 -1: Ljava/util/Stack; +49 -1: (Ljava/lang/String;)Ljava/lang/invoke/LambdaForm; +28 -1: java/security/DomainCombiner +53 -1: (Ljava/lang/String;Ljava/util/Map;)Ljava/time/ZoneId; +81 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)[Ljava/lang/reflect/AnnotatedType; +43 -1: java/lang/management/GarbageCollectorMXBean +11 -1: toTitleCase +12 -1: getHoldCount +4 -1: ()[B +4 -1: ()[C +4 -1: ()[J +20 -1: (Ljava/io/File;IZZ)Z +18 -1: fileTimeToUnixTime +23 -1: java/nio/HeapCharBuffer +30 -1: Ljava/lang/ref/ReferenceQueue; +6 -1: rt.jar +69 -1: (Ljava/util/function/ToIntFunction<-TT;>;)Ljava/util/Comparator; +21 -1: java/lang/ThreadLocal +25 -1: Ljava/lang/reflect/Field; +44 -1: (Ljava/lang/String;Ljava/lang/Throwable;ZZ)V +93 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/MethodHandle; +22 -1: getDayOfWeekDateBefore +37 -1: [Lsun/reflect/generics/tree/TypeTree; +83 -1: (Ljava/util/Map;)Ljava/util/Set; +10 -1: readFields +42 -1: (Ljava/net/URL;)Ljava/security/CodeSource; +44 -1: (Ljava/lang/String;IIJ)Ljava/nio/ByteBuffer; +27 -1: Ljava/util/Collection; +13 -1: checkResource +7 -1: rename0 +51 -1: (C)Ljava/lang/invoke/BoundMethodHandle$SpeciesData; +47 -1: sun/reflect/generics/repository/FieldRepository +11 -1: readBoolean +134 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$TreeNode;)V +13 -1: getZoneOffset +17 -1: getJdkVersionInfo +21 -1: sun/misc/MessageUtils +23 -1: defaultAllowArraySyntax +31 -1: java/util/concurrent/locks/Lock +24 -1: java/lang/reflect/Method +7 -1: toUpper +17 -1: sun/misc/Signal$1 +51 -1: (JLjava/util/function/BiFunction<-TK;-TK;+TK;>;)TK; +28 -1: (Ljava/lang/ref/Reference;)Z +8 -1: nthreads +26 -1: MapReduceEntriesToLongTask +27 -1: (Ljava/util/NavigableSet;)V +10 -1: savedProps +25 -1: Lsun/security/util/Debug; +12 -1: CR_MALFORMED +13 -1: com.sun.proxy +17 -1: CharSequence.java +24 -1: (ILjava/lang/String;II)Z +13 -1: findNextValue +108 -1: ;V:Ljava/lang/Object;>()Ljava/util/Comparator;>; +5 -1: (FF)F +9 -1: typeClass +5 -1: (FF)I +11 -1: segmentMask +7 -1: (JJJJ)V +14 -1: aliases_CESU_8 +85 -1: (Ljava/lang/Class;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle; +15 -1: getCalendarDate +21 -1: getDeclaredAnnotation +8 -1: ([BIIB)I +15 -1: stripExtensions +14 -1: getISO3Country +5 -1: short +47 -1: String value %s exceeds range of unsigned long. +34 -1: ()Ljava/security/ProtectionDomain; +8 -1: ([BIIB)V +23 -1: (Ljava/lang/Object;ID)V +47 -1: (Ljava/lang/String;Ljava/nio/charset/Charset;)V +29 -1: RuntimeVisibleTypeAnnotations +24 -1: (Ljava/io/InputStream;)V +39 -1: (Ljava/lang/Class;Ljava/lang/String;Z)V +16 -1: convertPrimitive +8 -1: (TK;)TV; +24 -1: (Ljava/io/InputStream;)Z +6 -1: start +243 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesToLongTask;Ljava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)V +9 -1: asSpecial +20 -1: java/text/Normalizer +17 -1: DAYS_0000_TO_1970 +9 -1: toCharset +20 -1: REPLACEALL_THRESHOLD +20 -1: sun/net/util/URLUtil +16 -1: findLoadedClass0 +14 -1: localedata.jar +6 -1: Parser +6 -1: start0 +4 -1: hash +83 -1: (Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;)Ljava/lang/invoke/MethodType; +29 -1: Ljava/lang/invoke/MemberName; +8 -1: BOOT_TAG +22 -1: MH_LINKER_ARG_APPENDED +14 -1: comparingByKey +47 -1: ([Ljava/lang/String;)Ljava/lang/ProcessBuilder; +6 -1: start= +18 -1: StringBuilder.java +7 -1: getLong +12 -1: copyElements +16 -1: highResFrequency +11 -1: toGMTString +10 -1: ISO_8859_1 +10 -1: ISO_8859_2 +6 -1: result +10 -1: ISO_8859_4 +10 -1: ISO_8859_5 +10 -1: ISO_8859_7 +15 -1: unmodifiableSet +10 -1: ISO_8859_9 +25 -1: NoClassDefFoundError.java +42 -1: (Ljava/lang/String;)Ljava/util/LinkedList; +14 -1: parallelPrefix +22 -1: ARRAY_LONG_INDEX_SCALE +6 -1: resume +36 -1: Ljava/lang/invoke/LambdaForm$Hidden; +50 -1: java/util/Collections$UnmodifiableRandomAccessList +130 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/Consumer;)V +6 -1: getInt +13 -1: getCachedYear +21 -1: CONNECTOR_PUNCTUATION +73 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/Object;ILjava/lang/Class;)V +24 -1: [Lsun/util/calendar/Era; +22 -1: (Ljava/lang/Object;D)V +74 -1: (Ljava/security/AccessControlContext;)Ljava/security/AccessControlContext; +109 -1: (Ljava/lang/Class<*>;Ljava/lang/Class$AnnotationData;Ljava/lang/Class$AnnotationData;)Z +6 -1: ([CZ)V +74 -1: (Ljava/util/HashMap$Node;Ljava/util/HashMap$Node;)Ljava/util/HashMap$Node; +19 -1: TRADITIONAL_CHINESE +125 -1: (Ljava/lang/Throwable$PrintStreamOrWriter;[Ljava/lang/StackTraceElement;Ljava/lang/String;Ljava/lang/String;Ljava/util/Set;)V +18 -1: unknown protocol: +57 -1: (Ljava/lang/reflect/Method;Lsun/reflect/MethodAccessor;)V +13 -1: writeComments +9 -1: Negotiate +14 -1: Closeable.java +10 -1: asSpreader +122 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind;[Ljava/nio/file/WatchEvent$Modifier;)Ljava/nio/file/WatchKey; +17 -1: jvm_minor_version +9 -1: getDouble +25 -1: Ljava/io/File$PathStatus; +19 -1: averageCharsPerByte +22 -1: getConstructorAccessor +61 -1: (Ljava/lang/String;)Ljava/lang/management/MemoryManagerMBean; +45 -1: (Ljava/lang/String;)Ljava/util/regex/Pattern; +25 -1: (JC)Ljava/nio/ByteBuffer; +20 -1: exclusiveOwnerThread +85 -1: (Ljava/lang/ClassValue;Ljava/lang/ClassValue$Entry;)V +17 -1: getExtensionValue +14 -1: getLoadAverage +17 -1: GET_PD_PERMISSION +6 -1: METHOD +23 -1: sun/nio/cs/ISO_8859_1$1 +23 -1: (I[Ljava/lang/Object;)I +4 1: zzz1 +13 -1: createWrapper +4 1: zzz2 +4 1: zzz3 +33 -1: greater than Character.MAX_RADIX +37 -1: DIRECTIONALITY_RIGHT_TO_LEFT_OVERRIDE +6 -1: BRIDGE +20 -1: canonicalizeLanguage +13 -1: setPermission +46 -1: (Ljava/io/OutputStream;)Ljava/io/OutputStream; +3 -1: 646 +14 -1: java/lang/Long +55 -1: java/util/concurrent/ConcurrentHashMap$SearchValuesTask +38 -1: (IC)Ljava/lang/invoke/LambdaForm$Name; +37 -1: (Ljava/lang/Class;)Ljava/lang/String; +17 -1: javaUtilJarAccess +23 -1: registerMethodsToFilter +34 -1: (Ljava/nio/charset/Charset;[CII)[B +11 -1: % VERSION 2 +37 -1: ([DI)Ljava/util/Spliterator$OfDouble; +16 -1: Stack Size: +52 -1: (Ljava/lang/Class;)Ljava/lang/annotation/Annotation; +17 -1: putDoubleVolatile +10 -1: access$500 +10 -1: access$502 +28 -1: malformed input around byte +13 -1: LF_INVSPECIAL +32 -1: Non-positive averageCharsPerByte +14 -1: NF_fieldOffset +10 -1: access$508 +48 -1: (TT;)Ljava/util/List; +17 -1: defaultReadObject +17 -1: java/util/TimSort +13 -1: resolveClass0 +92 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType; +20 -1: setLangReflectAccess +30 -1: java/lang/reflect/TypeVariable +56 -1: ([TT;)Ljava/util/Spliterator; +8 -1: VOLATILE +10 -1: Big5-HKSCS +23 -1: (Ljava/util/Locale$1;)V +15 -1: ISO_8859-1:1987 +14 -1: no such method +10 -1: null value +8 -1: checkURL +22 -1: ARRAY_BYTE_INDEX_SCALE +27 -1: (Ljava/lang/ClassLoader;Z)V +22 -1: java/lang/reflect/Type +25 -1: java/net/JarURLConnection +36 -1: java/util/WeakHashMap$KeySpliterator +26 -1: ()Lsun/misc/JavaAWTAccess; +50 -1: (I[Ljava/lang/Class;)Ljava/lang/invoke/MethodType; +9 -1: toDegrees +12 -1: lowSurrogate +19 -1: getEnclosingMethod0 +7 -1: bytearr +35 -1: (Ljava/util/List;Ljava/util/List;)I +25 -1: [Ljava/lang/reflect/Type; +34 -1: javaSecurityProtectionDomainAccess +21 -1: java.launcher.X.usage +37 -1: sun/util/locale/InternalLocaleBuilder +33 -1: ()Ljava/lang/invoke/MethodHandle; +3 -1: scl +19 -1: synthesizeAllParams +68 -1: Ljava/util/Map; +6 -1: vclass +35 -1: (Ljava/util/List;Ljava/util/List;)V +59 -1: Ljava/lang/Number;Ljava/lang/Comparable; +13 -1: CallSite.java +10 1: Bar loaded +21 -1: ARRAY_INT_BASE_OFFSET +49 -1: Ljava/util/concurrent/ConcurrentHashMap$TreeNode; +32 -1: [Ljava/lang/reflect/Constructor; +4 -1: type +34 -1: ([TT;II)[TT; +25 -1: BufferedOutputStream.java +23 -1: java/util/zip/ZipFile$1 +24 -1: ()Ljava/lang/ClassValue; +50 -1: (Ljava/util/concurrent/CountedCompleter;[F[FIIII)V +16 -1: getQueuedThreads +26 -1: getJavaNetHttpCookieAccess +8 -1: setExtra +8 -1: implRead +20 -1: linkMethod => throw +76 -1: (Ljava/util/function/ToDoubleFunction;Ljava/lang/Object;Ljava/lang/Object;)I +11 -1: KeyIterator +39 -1: Ljava/util/List; +3 -1: " " +36 -1: Ljava/lang/IllegalArgumentException; +11 -1: checkBounds +30 -1: sun/nio/cs/FastCharsetProvider +11 -1: toLongArray +107 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;IILjava/lang/String;[B)Ljava/lang/reflect/Field; +8 -1: (build +39 -1: (Ljava/nio/Buffer;ILjava/nio/Buffer;I)V +31 -1: [Ljava/lang/reflect/Executable; +3 -1: set +21 -1: PhantomReference.java +41 -1: java/util/Collections$CheckedNavigableMap +53 -1: Can not make a java.lang.Class constructor accessible +12 -1: ([CII[CIII)I +55 -1: Ljava/util/HashMap; +12 -1: MICROSECONDS +11 -1: writeBuffer +52 -1: and domain that didn't have permission +37 -1: java/nio/channels/WritableByteChannel +26 -1: getRawClassTypeAnnotations +15 -1: putCharVolatile +33 -1: java/security/InvalidKeyException +19 -1: Ljava/io/Closeable; +83 -1: Lsun/util/locale/LocaleObjectCache; +10 -1: SetFromMap +24 -1: JavaFX-Application-Class +13 -1: asShortBuffer +10 -1: getReifier +15 -1: isPositionIndex +18 -1: SignalHandler.java +3 -1: JST +28 -1: (Ljava/io/FileDescriptor;I)I +28 -1: getStackAccessControlContext +16 -1: updateByteBuffer +27 -1: ()Ljava/net/ContentHandler; +25 -1: (JD)Ljava/nio/ByteBuffer; +39 -1: ()Lsun/misc/JavaIOFileDescriptorAccess; +107 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry; +42 -1: sun/misc/PerfCounter$WindowsClientCounters +8 -1: addExact +28 -1: (Ljava/io/FileDescriptor;I)V +36 -1: ([Ljava/lang/String;)Ljava/util/Map; +21 -1: ()Ljava/lang/Process; +4 -1: UTF8 +5 -1: mkdir +10 -1: transient +3 -1: sgp +15 -1: balanceDeletion +161 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/net/URL;)Ljava/lang/Package; +15 -1: SynchronizedMap +40 -1: sun.misc.URLClassPath.disableJarChecking +92 -1: Ljava/util/AbstractSet;Ljava/util/Set;Ljava/io/Serializable; +17 -1: removeEldestEntry +35 -1: (I)Ljava/lang/Class$AnnotationData; +24 -1: Ljava/util/Locale$Cache; +13 -1: STANDARD_TIME +17 -1: sun/nio/cs/MS1252 +99 -1: ()Ljava/util/concurrent/ConcurrentHashMap$KeySetView; +23 -1: java/util/LinkedHashSet +9 -1: iso8859_1 +9 -1: iso8859_2 +9 -1: iso8859_4 +66 -1: (Ljava/lang/Class;)[TA; +9 -1: iso8859_5 +9 -1: iso8859_7 +9 -1: iso8859_9 +21 -1: Ljava/util/Formatter; +6 -1: isPath +21 -1: makeReferenceIdentity +24 -1: sun/net/ApplicationProxy +23 -1: ClassCastException.java +11 -1: MethodArray +12 -1: SingletonMap +41 -1: java/util/ArrayPrefixHelpers$CumulateTask +7 -1: seconds +20 -1: ClassRepository.java +14 -1: allocateMemory +24 -1: java.launcher.jar.error1 +24 -1: java.launcher.jar.error2 +24 -1: java.launcher.jar.error3 +45 -1: (Ljava/lang/String;Ljava/util/jar/Manifest;)Z +3 -1: sin +7 -1: (J[II)I +3 -1: Itr +18 -1: findBootstrapClass +10 -1: getElement +15 -1: ISO_8859-4:1988 +34 -1: newGetLongIllegalArgumentException +7 -1: pending +17 -1: isNotContinuation +6 -1: EXTSIG +13 -1: searchMethods +32 -1: Lsun/misc/JavaUtilZipFileAccess; +33 -1: ([Ljava/lang/reflect/Parameter;)V +31 -1: defaultUncaughtExceptionHandler +89 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind<*>;)Ljava/nio/file/WatchKey; +5 -1: ASCII +28 -1: ()Lsun/reflect/ConstantPool; +20 -1: isJavaIdentifierPart +6 -1: EXTSIZ +34 -1: Lsun/misc/JavaNetHttpCookieAccess; +34 -1: ClassLoader object not initialized +7 -1: CHECKED +16 -1: encodeBufferLoop +37 -1: (Ljava/time/Instant;)Ljava/util/Date; +24 -1: (Ljava/util/Map$Entry;)Z +50 -1: java/util/concurrent/ConcurrentHashMap$KeyIterator +31 -1: ()[Ljava/lang/ClassValue$Entry; +31 -1: java/lang/IllegalStateException +43 -1: (Ljava/lang/Appendable;Ljava/util/Locale;)V +6 -1: CENVEM +53 -1: Ljava/util/ArrayList; +17 -1: getHeaderFieldKey +71 -1: (Ljava/lang/CharSequence;Ljava/text/Normalizer$Form;)Ljava/lang/String; +6 -1: CENVER +17 -1: cleanStaleEntries +9 -1: linkFirst +57 -1: (Ljava/util/Comparator<-TT;>;)Ljava/util/Comparator; +8 -1: val$file +27 -1: Invalid parameter modifiers +6 -1: append +57 -1: ()Lsun/reflect/generics/repository/ConstructorRepository; +65 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsToIntTask +39 -1: (Ljava/lang/String;)Ljava/lang/Integer; +25 -1: lambda$parallelSetAll$191 +25 -1: lambda$parallelSetAll$192 +25 -1: lambda$parallelSetAll$193 +23 -1: INSERTIONSORT_THRESHOLD +17 -1: java/time/Instant +25 -1: lambda$parallelSetAll$194 +14 -1: dynamicInvoker +9 -1: iso646-us +8 -1: position +29 -1: java/nio/channels/FileChannel +27 -1: java/util/stream/Collectors +64 -1: (Ljava/lang/CharSequence;Ljava/lang/Iterable;)Ljava/lang/String; +10 -1: INDEX_NAME +15 -1: getCommentBytes +67 -1: (Ljava/io/FileOutputStream;Ljava/lang/String;)Ljava/io/PrintStream; +22 -1: privateGetPublicFields +32 -1: java/util/BitSet$1BitSetIterator +12 -1: PERF_MODE_RO +89 -1: ([Ljava/lang/ClassValue$Entry;ILjava/lang/ClassValue$Entry;Z)Ljava/lang/ClassValue$Entry; +30 -1: java/security/PrivilegedAction +18 -1: host can't be null +26 -1: package name can't be null +12 -1: PERF_MODE_RW +10 -1: isEnqueued +18 -1: argSlotToParameter +37 -1: (II)Ljava/lang/AbstractStringBuilder; +5 -1: tabAt +53 -1: (Ljava/lang/Object;)Ljava/lang/AbstractStringBuilder; +11 -1: PATH_OFFSET +18 -1: unicodebigunmarked +15 -1: ConditionObject +6 -1: KOREAN +13 -1: isNamePresent +24 -1: ()Ljava/lang/Class; +14 -1: isStandardTime +8 -1: ([IIII)I +9 -1: WeakEntry +12 -1: javaIOAccess +17 -1: key can't be null +129 -1: Ljava/lang/Object;Ljava/lang/Comparable;Ljava/lang/Iterable;Ljava/nio/file/Watchable; +8 -1: handler +8 -1: ([IIII)V +10 -1: atBugLevel +18 -1: makeGuardWithCatch +18 -1: currentLoadedClass +11 -1: getCodeBase +67 -1: (Ljava/util/List<+TT;>;)Ljava/util/List; +12 -1: JarFile.java +19 -1: (C)Ljava/io/Writer; +22 -1: createURLStreamHandler +23 -1: sun/nio/cs/ArrayDecoder +13 -1: setAccessible +18 -1: stripOffParameters +101 -1: ([Ljava/security/ProtectionDomain;[Ljava/security/ProtectionDomain;)[Ljava/security/ProtectionDomain; +18 -1: Ljava/util/Random; +16 -1: Pacific/Honolulu +13 -1: useOldMapping +65 -1: (Ljava/lang/invoke/LambdaForm$NamedFunction;[Ljava/lang/Object;)V +14 -1: filterArgument +12 -1: LF_MH_LINKER +25 -1: isDirectMemoryPageAligned +49 -1: (Ljava/util/BitSet;)Ljava/util/function/Supplier; +54 -1: (Ljava/util/concurrent/ConcurrentHashMap;TV;)V +16 -1: java/time/ZoneId +4 -1: zfot +18 -1: isSameClassPackage +6 -1: julian +8 -1: (TT;)TT; +22 -1: java/util/jar/Manifest +7 -1: charOut +16 -1: getOffsetsByWall +19 -1: Illegal replacement +139 -1: Ljava/util/AbstractList;Ljava/util/List;Ljava/util/RandomAccess;Ljava/lang/Cloneable;Ljava/io/Serializable; +96 -1: (Ljava/lang/reflect/Constructor;)Ljava/lang/reflect/Constructor; +15 -1: Annotation.java +24 -1: (Ljava/lang/Class<*>;)[B +6 -1: CODING +34 -1: ([Ljava/lang/ClassValue$Entry;II)V +6 -1: IGNORE +62 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodHandle; +29 -1: specificToGenericStringHeader +12 -1: helpTransfer +8 -1: fastTime +62 -1: (Ljava/net/URLConnection;[Ljava/lang/Class;)Ljava/lang/Object; +18 -1: Unhandled signal: +8 -1: isStrict +15 -1: ISO_8859-7:1987 +13 -1: getWeekLength +14 -1: jvmBuildNumber +40 -1: (Ljava/lang/String;)Ljava/util/Iterator; +6 -1: short0 +6 -1: short1 +73 -1: (Ljava/security/PrivilegedExceptionAction;)TT; +10 -1: removeNode +8 -1: setFloat +18 -1: cspc862latinhebrew +11 -1: setTimeZone +34 -1: java/lang/reflect/AccessibleObject +25 -1: MapReduceKeysToDoubleTask +25 -1: java/lang/ref/Reference$1 +24 -1: java/nio/HeapByteBufferR +15 -1: jdkMicroVersion +117 -1: (Ljava/lang/Class;Ljava/lang/String;[Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B[B)V +8 -1: (TT;)TV; +16 -1: Permissions.java +22 -1: Ljava/util/Comparator; +17 -1: getDaylightSaving +25 -1: ([BIILjava/lang/String;)V +9 -1: stillborn +11 -1: maxPosition +28 -1: java/util/ArrayPrefixHelpers +73 -1: ()Ljava/util/SortedMap; +14 -1: useCanonCaches +5 -1: clean +16 -1: checkPermission2 +34 -1: sun.misc.launcher.useSharedArchive +13 -1: shutdownHooks +5 -1: clear +240 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysToLongTask;Ljava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)V +67 -1: (JLjava/util/function/Function<-TV;+TU;>;)TU; +6 -1: cp1250 +6 -1: cp1251 +6 -1: cp1252 +13 -1: getZipMessage +6 -1: cp1253 +28 -1: (J)Ljava/lang/ref/Reference; +6 -1: cp1254 +54 -1: (ILjava/lang/String;)Ljava/lang/AbstractStringBuilder; +6 -1: cp1257 +10 -1: deepEquals +17 -1: WRITE_BUFFER_SIZE +13 -1: copyFromArray +40 -1: java/util/Collections$ReverseComparator2 +36 -1: sun/reflect/generics/visitor/Reifier +19 -1: averageBytesPerChar +13 -1: javaAWTAccess +6 -1: cp5346 +61 -1: Ljava/util/Map; +6 -1: cp5347 +6 -1: cp5348 +6 -1: cp5349 +5 -1: field +23 -1: ()Ljava/nio/LongBuffer; +103 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/WrongMethodTypeException; +37 -1: (I)Ljava/lang/Character$UnicodeBlock; +11 -1: offsetAfter +79 -1: Ljava/util/HashMap; +27 -1: invocationHandlerReturnType +17 -1: POSITIVE_INFINITY +11 -1: maybeRebind +3 -1: str +18 -1: setSecurityManager +9 -1: signature +18 -1: corrupted jar file +89 -1: Ljava/lang/Object;Ljava/util/Collection;Ljava/io/Serializable; +87 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object; +6 -1: CENATT +6 -1: cp5350 +12 -1: AF_GETSTATIC +38 -1: (TE;Ljava/util/LinkedList$Node;)V +8 -1: isLoaded +6 -1: CENATX +6 -1: cp5353 +18 -1: Africa/Addis_Ababa +35 -1: sun/usagetracker/UsageTrackerClient +11 -1: toUpperCase +22 -1: java/util/zip/Inflater +10 -1: iso_8859-1 +10 -1: iso_8859-2 +3 -1: sum +7 -1: x-Johab +10 -1: iso_8859-4 +10 -1: iso_8859-5 +85 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class;)Ljava/security/AccessControlContext; +11 -1: activeCount +49 -1: (Ljava/lang/ClassLoader;Ljava/lang/ClassLoader;)Z +51 -1: (Ljava/util/List;Ljava/lang/Class;)Ljava/util/List; +10 -1: iso_8859-7 +19 -1: appendVmErgoMessage +10 -1: iso_8859-9 +14 -1: getClassLoader +6 -1: (CJJ)Z +15 -1: Lsun/misc/Perf; +7 -1: getTree +27 -1: Ljava/text/Normalizer$Form; +11 -1: ISO-2022-JP +69 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Object;)Ljava/lang/Object; +50 -1: java/lang/invoke/DirectMethodHandle$StaticAccessor +15 -1: fxLauncherClass +35 -1: (Ljava/net/URL;Ljava/lang/String;)V +16 -1: getAndAccumulate +35 -1: (Ljava/net/URL;Ljava/lang/String;)Z +32 -1: Non-positive averageBytesPerChar +35 -1: Ljava/lang/Class; +15 -1: CLASS_MODIFIERS +12 -1: checkedQueue +13 -1: enumConstants +10 -1: getFactory +95 -1: Ljava/util/concurrent/ConcurrentMap;>; +13 -1: Africa/Harare +57 -1: (JLjava/util/TimeZone;)Lsun/util/calendar/Gregorian$Date; +11 -1: ISO-2022-KR +19 -1: $assertionsDisabled +13 -1: PROXY_PACKAGE +17 -1: copyFromLongArray +81 -1: Ljava/util/LinkedHashMap$Entry; +11 -1: checkDelete +38 -1: sun/management/ManagementFactoryHelper +7 -1: UTC1900 +20 -1: getBootstrapResource +23 -1: ()Ljava/lang/Throwable; +16 -1: CALLER_SENSITIVE +26 -1: checkSystemClipboardAccess +32 -1: Can't set default locale to NULL +16 -1: fxLauncherMethod +4 -1: >= +8 -1: provider +9 -1: Finalizer +78 -1: (Ljava/io/FileDescriptor;ZZZLjava/lang/Object;)Ljava/nio/channels/FileChannel; +13 -1: emptyIterator +15 -1: getZipFileCount +21 -1: isJavaIdentifierStart +9 -1: connected +11 -1: (ITK;TV;I)V +16 -1: America/Honolulu +22 -1: SynchronizedCollection +28 -1: java/util/zip/ZipConstants64 +29 -1: inheritedAccessControlContext +29 -1: ()[Ljava/security/CodeSigner; +85 -1: (JLjava/lang/String;Ljava/lang/String;Ljava/lang/String;Lcom/sun/management/GcInfo;)V +25 -1: (Ljava/nio/CharBuffer;Z)V +15 -1: java/io/Console +101 -1: (Ljava/lang/Class<*>;Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z +9 -1: | resolve +81 -1: (BLjava/lang/invoke/MemberName;Ljava/lang/Class<*>;)Ljava/lang/invoke/MemberName; +33 -1: (Ljava/nio/charset/Charset;FF[B)V +49 -1: (Ljava/lang/Class;Z)Ljava/lang/invoke/MethodType; +66 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/io/File;)Ljava/io/File; +29 -1: ([Ljava/util/HashMap$Node;I)V +13 -1: filterMethods +4 -1: jcal +61 -1: (Ljava/util/List;>;)[Ljava/lang/Class<*>; +6 -1: which= +46 -1: (Ljava/math/BigInteger;)Ljava/math/BigInteger; +4 -1: date +18 -1: internalMemberName +6 -1: (JJI)Z +30 -1: [Ljava/lang/invoke/LambdaForm; +60 -1: Ljava/lang/Object; +15 -1: ReservationNode +42 -1: java/lang/ThreadLocal$ThreadLocalMap$Entry +6 -1: setIn0 +4 -1: sort +8 -1: ibm00858 +110 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;IILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class; +28 -1: Ljava/lang/ClassValue$Entry; +22 -1: ensureExplicitCapacity +6 -1: rotate +14 -1: closeRequested +30 -1: ([CII)Ljava/lang/StringBuffer; +10 -1: LM_UNKNOWN +15 -1: Comparable.java +13 -1: getByteBuffer +9 -1: getScheme +15 -1: done with meta! +17 -1: checkForTypeAlias +7 -1: getKeys +7 -1: SIG_DFL +30 -1: Ljava/nio/charset/CoderResult; +16 -1: returnTypesMatch +19 -1: getClassAccessFlags +18 -1: JavaNioAccess.java +9 -1: setDouble +23 -1: Ljava/util/zip/ZipFile; +83 -1: (JLjava/util/function/ToIntFunction<-TK;>;ILjava/util/function/IntBinaryOperator;)I +11 -1: ACCESS_READ +15 -1: nativeByteOrder +5 -1: hours +7 -1: toArray +7 -1: Encoder +12 -1: resolveClass +29 -1: (Ljava/io/FileDescriptor;JJ)V +14 -1: redefinedCount +8 -1: getTotal +11 -1: iso_8859-13 +11 -1: iso_8859-15 +9 -1: expected +18 -1: getDeclaredMethods +11 -1: elementData +6 -1: intern +10 -1: countryKey +6 -1: setInt +39 -1: Could not create extension class loader +24 -1: SELF_SUPPRESSION_MESSAGE +14 -1: argToSlotTable +42 -1: Ljava/util/HashMap; +5 -1: \t\n\r\x0c +4 -1: read +12 -1: Objects.java +7 -1: aliases +29 -1: sun/reflect/LangReflectAccess +6 -1: prefix +15 -1: superInterfaces +10 -1: getDoInput +30 -1: java/nio/CharBufferSpliterator +6 -1: KOI8_R +12 -1: Asia/Kolkata +6 -1: KOI8_U +6 -1: LOCSIG +15 -1: UA-Java-Version +92 -1: Ljava/util/HashMap;Ljava/util/Map; +14 -1: CertificateRep +17 -1: getSystemResource +85 -1: (JLjava/util/function/ToLongFunction<-TV;>;JLjava/util/function/LongBinaryOperator;)J +27 -1: java/lang/reflect/Parameter +5 -1: quote +8 -1: not MH: +46 -1: java/util/Collections$UnmodifiableCollection$1 +6 -1: putVal +6 -1: LOCSIZ +6 -1: Atomic +3 -1: 737 +38 -1: java/lang/UnsupportedClassVersionError +27 -1: ()Ljava/lang/StringBuilder; +41 -1: sun/net/www/protocol/jar/JarURLConnection +60 -1: (Ljava/lang/String;[Ljava/lang/Object;)Ljava/util/Formatter; +59 -1: (TT;TT;Ljava/util/Comparator<-TT;>;)I +54 -1: java/util/concurrent/locks/AbstractOwnableSynchronizer +7 -1: getHost +36 -1: (F)Ljava/lang/AbstractStringBuilder; +69 -1: (Ljava/lang/Class;)Ljava/lang/Class<+TU;>; +4 -1: Form +103 -1: (Ljava/util/SortedMap;)Ljava/util/SortedMap; +6 -1: spread +8 -1: addHours +13 -1: contentEquals +47 -1: (Ljava/lang/String;Ljava/security/Permission;)V +12 -1: newCondition +23 -1: (Ljava/lang/Object;IZ)V +26 -1: (Ljava/util/LinkedList;I)V +13 -1: ConstantValue +18 -1: URLConnection.java +12 -1: Boolean.java +75 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;Ljava/net/URLStreamHandlerFactory;)V +21 -1: EMPTY_THROWABLE_ARRAY +153 -1: (Ljava/util/Map;[Ljava/lang/String;>;Ljava/lang/Class<*>;[Ljava/lang/String;)Ljava/util/Map;[Ljava/lang/String;>; +18 -1: getUnresolvedCerts +13 -1: Negative time +28 -1: java/util/WeakHashMap$KeySet +8 -1: slashify +16 -1: isOtherLowercase +17 -1: putObjectVolatile +5 -1: ERASE +12 -1: filterFields +40 -1: Ljava/lang/ReflectiveOperationException; +12 -1: VM settings: +57 -1: (ILjava/lang/Object;)Ljava/util/HashMap$TreeNode; +10 -1: access$600 +11 -1: ] return => +13 -1: user.timezone +23 -1: USER_AGENT_JAVA_VERSION +27 -1: (Ljava/util/HashMap$Node;)V +19 -1: filterNTLMResponses +28 -1: (Lsun/misc/VMNotification;)V +37 -1: ()[[Ljava/lang/annotation/Annotation; +45 -1: ()Lcom/sun/management/DiagnosticCommandMBean; +3 -1: tan +31 -1: getDirectlyAndIndirectlyPresent +7 -1: prepend +35 -1: (I)Lsun/util/calendar/CalendarDate; +8 -1: val$dirs +4 -1: test +28 -1: Non-positive maxCharsPerByte +83 -1: Ljava/lang/Object;Ljava/util/Map; +12 -1: JAVA_VERSION +24 -1: ([Ljava/lang/Thread;IZ)I +70 -1: (Ljava/lang/invoke/LambdaForm$Name;)Ljava/lang/invoke/LambdaForm$Name; +57 -1: ([TT;Ljava/util/Comparator<-TT;>;)V +42 -1: (Ljava/lang/Class<*>;[I)Ljava/lang/Object; +27 -1: java/lang/SecurityManager$1 +32 -1: java/security/SignatureException +27 -1: java/lang/SecurityManager$2 +4 -1: .jar +20 -1: parameterAnnotations +31 -1: DIRECTIONALITY_BOUNDARY_NEUTRAL +21 -1: hasClassPathAttribute +17 -1: checkParentAccess +35 -1: java/security/PermissionsEnumerator +6 -1: FORMAT +92 -1: (JLjava/util/function/Function;+TU;>;)TU; +3 -1: 775 +11 -1: PROBE_LIMIT +111 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/String;)Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater; +11 -1: AF_PUTFIELD +22 -1: (Ljava/lang/Object;Z)V +20 -1: getGenericReturnType +9 -1: val$extcl +13 -1: inClassLoader +37 -1: sun.urlClassLoader.readClassBytesTime +35 -1: (JLjava/util/function/BiConsumer;)V +28 -1: getContentHandlerPkgPrefixes +10 -1: getChannel +78 -1: (Ljava/util/List<+TT;>;TT;Ljava/util/Comparator<-TT;>;)I +16 -1: parseMemberValue +4 -1: regn +47 -1: ([Ljava/lang/Object;III)Ljava/util/Spliterator; +11 -1: but found +6 -1: adjust +11 -1: isLowerCase +29 -1: sun/reflect/ReflectionFactory +98 -1: (Ljava/util/SortedSet;Ljava/lang/Class;)Ljava/util/SortedSet; +18 -1: [Ljava/lang/Error; +5 -1: entry +14 -1: refreshVersion +8 -1: (IIIII)V +22 -1: unmodifiableCollection +6 -1: putAll +22 -1: offsetByCodePointsImpl +26 -1: (Ljava/lang/String;[BII)[C +46 -1: (Ljava/net/URLClassLoader;Ljava/lang/String;)V +4 -1: /LF= +9 -1: Bits.java +30 -1: [Ljava/util/WeakHashMap$Entry; +19 -1: getLastModifiedTime +44 -1: [Ljava/lang/Thread$UncaughtExceptionHandler; +11 -1: getZoneInfo +6 -1: lookup +19 -1: MapReduceValuesTask +18 -1: isVarargsCollector +38 -1: java/util/jar/JarFile$JarEntryIterator +11 -1: getJarIndex +9 -1: getByName +42 -1: (Ljava/lang/Object;JLjava/lang/Object;JJ)V +71 -1: (Ljava/lang/invoke/LambdaForm$Name;I)Ljava/lang/invoke/LambdaForm$Name; +30 -1: java/net/ContentHandlerFactory +54 -1: (Ljava/lang/Class<*>;I)Ljava/lang/invoke/MethodHandle; +12 -1: getSignature +9 -1: parseLong +25 -1: DEBUG_METHOD_HANDLE_NAMES +15 -1: runFinalization +13 -1: 0000000000000 +28 -1: ()[Ljava/lang/reflect/Field; +37 -1: ([Ljava/lang/ClassValue$Entry<*>;II)V +13 -1: gcInfoBuilder +64 -1: (JLjava/util/function/BiFunction;Ljava/util/function/Consumer;)V +5 -1: cnfe1 +8 -1: setShort +28 -1: (C)Ljava/lang/StringBuilder; +44 -1: (Ljava/nio/LongBuffer;)Ljava/nio/LongBuffer; +70 -1: (Ljava/lang/String;[BIILjava/security/CodeSource;)Ljava/lang/Class<*>; +33 -1: java/lang/TypeNotPresentException +5 -1: \n +20 -1: acquireInterruptibly +21 -1: (I)Ljava/lang/String; +24 -1: (Ljava/io/PrintWriter;)V +16 -1: convertArguments +32 -1: Ljava/net/MalformedURLException; +15 -1: linkToInterface +39 -1: java/lang/Throwable$PrintStreamOrWriter +10 -1: iso8859_13 +13 -1: hasPrimitives +10 -1: iso8859_15 +145 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Class<*>;)Ljava/lang/invoke/CallSite; +8 -1: equalPDs +28 -1: (Ljava/io/FileDescriptor;J)V +7 -1: newLine +43 -1: (Ljava/lang/Class<*>;I)Ljava/lang/Class<*>; +8 -1: addEntry +30 -1: java/util/WeakHashMap$EntrySet +14 -1: USE_OLDMAPPING +39 -1: (Ljava/io/DataInput;)Ljava/lang/String; +12 -1: LF_EX_LINKER +27 -1: java/lang/invoke/MethodType +23 -1: JavaSecurityAccess.java +23 -1: isLocalOrAnonymousClass +19 -1: Expanded arguments: +18 -1: sun/nio/cs/Unicode +40 -1: ()Ljava/nio/charset/spi/CharsetProvider; +23 -1: ([BLjava/lang/String;)V +7 -1: default +13 -1: highestOneBit +9 -1: isDefault +28 -1: (IF)Ljava/lang/StringBuffer; +31 -1: ()Ljava/util/ListIterator; +4 -1: base +23 -1: newPermissionCollection +7 -1: version +15 -1: Permission.java +41 -1: java/lang/invoke/LambdaForm$NamedFunction +8 -1: isQueued +24 -1: ([Ljava/lang/Class<*>;)I +64 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesToIntTask +16 -1: checkInitialized +37 -1: java/lang/ClassLoader$ParallelLoaders +5 -1: ([B)I +23 -1: Lsun/misc/URLClassPath; +9 -1: usr_paths +10 -1: Queue.java +43 -1: (Ljava/io/File;Ljava/nio/charset/Charset;)V +64 -1: (Ljava/lang/invoke/MethodTypeForm;)Ljava/lang/invoke/MemberName; +3 -1: tid +23 -1: JarIndex-Version: 1.0\n\n +33 -1: (I)Ljava/nio/charset/CoderResult; +5 -1: ([B)V +10 -1: isInstance +25 -1: unmappableCharacterAction +11 -1: queueLength +5 -1: ([B)Z +10 -1: freeMemory +47 -1: java/util/ArrayPrefixHelpers$DoubleCumulateTask +52 -1: (Ljava/util/Map;Ljava/lang/Class;Ljava/lang/Class;)V +41 -1: Ljava/util/Collections$ReverseComparator; +16 -1: copyToShortArray +206 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;ILjava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$Node;)Z +38 -1: sun/launcher/LauncherHelper$SizePrefix +17 -1: ACCESS_PERMISSION +17 -1: ReverseComparator +30 -1: ()Ljava/lang/ClassValue$Entry; +17 -1: AF_PUTSTATIC_INIT +6 -1: (IIB)I +19 -1: java/nio/file/Files +35 -1: (Z)[Ljava/lang/reflect/Constructor; +20 -1: INVALID_FIELD_OFFSET +17 -1: initializeHeaders +10 -1: management +10 -1: targetType +61 -1: (Ljava/util/SortedSet;Ljava/lang/Class;)Ljava/util/SortedSet; +5 -1: ascii +8 -1: validate +78 -1: Ljava/util/concurrent/ConcurrentHashMap; +25 -1: sun/nio/cs/UTF_16$Decoder +36 -1: sun/management/DiagnosticCommandImpl +24 -1: unmodifiableNavigableMap +18 -1: canonicalizeScript +29 -1: Lsun/misc/JavaSecurityAccess; +74 -1: ([JLjava/util/function/IntToLongFunction;)Ljava/util/function/IntConsumer; +38 -1: DIRECTIONALITY_LEFT_TO_RIGHT_EMBEDDING +11 -1: languageTag +33 -1: java/lang/invoke/VolatileCallSite +18 -1: setRequestProperty +6 -1: 0x%02X +20 -1: (Ljava/lang/Float;)I +35 -1: (Ljava/nio/charset/CoderResult$1;)V +24 -1: (Ljava/lang/Object;JJB)V +21 -1: synchronizedSortedSet +59 -1: (Ljava/util/function/ToLongFunction;)Ljava/util/Comparator; +30 -1: av.length == arity: av.length= +7 -1: $VALUES +27 -1: RandomNumberGeneratorHolder +3 -1: tlr +43 -1: java/util/ArraysParallelSortHelpers$FJFloat +28 -1: ()[Ljava/io/File$PathStatus; +26 -1: invalid extra field length +13 -1: getExtensions +7 -1: PARAMS0 +7 -1: PARAMS1 +30 -1: [Ljava/lang/invoke/MemberName; +7 -1: PARAMS2 +31 -1: java/lang/AbstractStringBuilder +161 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/BiFunction;Ljava/util/function/Consumer;)V +4 -1: repl +19 -1: ()Ljava/lang/Class; +24 -1: BufferedInputStream.java +9 -1: sizeCache +8 -1: READLINK +9 -1: metaIndex +18 -1: getLocalizedObject +6 -1: filter +58 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;I)V +140 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName; +24 -1: Ljava/util/HashMap$Node; +35 -1: (Lsun/nio/cs/FastCharsetProvider;)V +8 -1: dispatch +19 -1: sun.stderr.encoding +130 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/util/List; +51 -1: Ljava/util/concurrent/ConcurrentHashMap$ValuesView; +30 -1: sun.reflect.inflationThreshold +20 -1: MutableCallSite.java +26 -1: invokeWithArgumentsTracing +7 -1: getters +38 -1: ()[Ljava/lang/reflect/TypeVariable<*>; +46 -1: ([DLjava/util/function/DoubleBinaryOperator;)V +5 -1: klass +13 -1: publicMethods +37 -1: ()[Ljava/lang/reflect/Constructor<*>; +126 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle; +6 -1: FJLong +20 -1: canBeStaticallyBound +17 -1: getTimezoneOffset +9 -1: ALL_TYPES +3 -1: toV +8 -1: packages +15 -1: codePointBefore +10 -1: getCountry +13 -1: getDSTSavings +100 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetDecoder;)Lsun/nio/cs/StreamDecoder; +50 -1: java/util/ArraysParallelSortHelpers$FJFloat$Sorter +20 -1: hasNonVoidPrimitives +7 -1: syncAll +41 -1: domain dump all domains in context +59 -1: Ljava/util/Hashtable; +16 -1: ForEachEntryTask +18 -1: vminfoIsConsistent +26 -1: (ZLjava/util/Comparator;)V +9 -1: Lock.java +31 -1: Lsun/reflect/ReflectionFactory; +8 -1: (I[BII)I +23 -1: doesExtendFXApplication +87 -1: java/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl +11 -1: windows-31j +28 -1: sun/misc/URLClassPath$Loader +17 -1: getEntryAfterMiss +47 -1: ([Ljava/lang/reflect/Field;Ljava/lang/String;)J +44 -1: Ljava/util/List; +10 -1: openStream +31 -1: Ljava/net/UnknownHostException; +19 -1: bad reference kind +29 -1: ()Ljava/nio/MappedByteBuffer; +9 -1: H_UPALPHA +37 -1: (Ljava/util/function/UnaryOperator;)V +25 -1: FAKE_METHOD_HANDLE_INVOKE +4 -1: peek +25 -1: java/util/Hashtable$Entry +18 -1: getMemberRefInfoAt +37 -1: Ljava/util/WeakHashMap$Entry; +14 -1: resolvedHandle +27 -1: ()Ljava/util/Iterator; +61 -1: Ljava/util/Map; +6 -1: static +50 -1: (Ljava/net/URLClassLoader;)Lsun/misc/URLClassPath; +38 -1: (Ljava/lang/Class;)[Ljava/lang/Object; +41 -1: (Ljava/util/SortedSet;Ljava/lang/Class;)V +41 -1: java/lang/invoke/WrongMethodTypeException +5 -1: group +10 -1: readObject +13 -1: getParentFile +14 -1: daylightSaving +15 -1: eagerValidation +36 -1: (Ljava/io/File;)Lsun/misc/MetaIndex; +18 -1: reduceEntriesToInt +15 -1: INITIAL_ENTRIES +18 -1: AtomicInteger.java +7 -1: .length +128 -1: Ljava/nio/Buffer;Ljava/lang/Comparable;Ljava/lang/Appendable;Ljava/lang/CharSequence;Ljava/lang/Readable; +6 -1: asList +21 -1: unmodifiableSortedSet +22 -1: ([B)Ljava/util/BitSet; +5 -1: check +64 -1: (Ljava/util/jar/JarFile;Lsun/misc/MetaIndex;)Lsun/misc/JarIndex; +35 -1: ()Ljava/nio/charset/CharsetEncoder; +4 -1: oome +25 -1: ()Lsun/misc/URLClassPath; +27 -1: (Ljava/io/FilePermission;)V +29 -1: IllegalArgumentException.java +17 -1: jvmSpecialVersion +21 -1: Ljava/util/ArrayList; +13 -1: packagePrefix +27 -1: (Ljava/io/FilePermission;)Z +11 -1: canonicalID +82 -1: Ljava/lang/Object;Ljava/util/Comparator;Ljava/io/Serializable; +24 -1: java.launcher.opt.footer +13 -1: NativeLibrary +37 -1: (Ljava/lang/String;J)Ljava/lang/Long; +16 -1: longBitsToDouble +6 -1: getKey +22 -1: (JLjava/lang/String;)V +14 -1: ensureCapacity +69 -1: (Ljava/lang/Object;Ljava/util/function/BiFunction;)Ljava/lang/Object; +22 -1: java/lang/Thread$State +50 -1: ()Ljava/util/Iterator; +4 -1: 7bit +46 -1: (Ljava/lang/Class<+Ljava/lang/ClassLoader;>;)Z +76 -1: (ILjava/util/List;>;)[Ljava/lang/invoke/LambdaForm$Name; +3 -1: ttb +12 -1: UTF_16LE_BOM +9 -1: remainder +40 -1: ()Lsun/reflect/generics/visitor/Reifier; +22 -1: [Ljava/lang/Throwable; +17 -1: EMPTY_ENUMERATION +13 -1: erasedInvoker +46 -1: Ljava/nio/charset/IllegalCharsetNameException; +10 -1: UnicodeBig +53 -1: ()Ljava/util/Map; +12 -1: MAX_EXPONENT +10 -1: Enumerator +15 -1: charset decoder +11 -1: AF_GETFIELD +12 -1: | getInvoker +74 -1: (Ljava/nio/ByteBuffer;Ljava/nio/CharBuffer;)Ljava/nio/charset/CoderResult; +14 -1: toUnsignedLong +46 -1: java/lang/invoke/MethodHandleNatives$Constants +29 -1: java version "1.8.0-internal" +21 -1: ([Ljava/lang/Class;)I +16 -1: UPPERCASE_LETTER +22 -1: newConstantPerfCounter +6 -1: signum +9 -1: getField0 +38 -1: java/nio/charset/CoderMalfunctionError +21 -1: [Ljava/lang/Runnable; +11 -1: putIfAbsent +30 -1: java/util/Collections$EmptySet +22 -1: (I)[Ljava/lang/String; +34 -1: Ljava/security/SecurityPermission; +49 -1: ([Ljava/lang/Class;)Ljava/lang/invoke/MethodType; +190 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$ReduceEntriesTask;Ljava/util/function/BiFunction;)V +22 -1: Not an annotation type +34 -1: java/io/ObjectInputStream$GetField +50 -1: (Lsun/reflect/FieldInfo;)Ljava/lang/reflect/Field; +32 -1: Ljava/lang/NoSuchFieldException; +70 -1: (Ljava/lang/invoke/MethodHandle;[Ljava/lang/Object;)Ljava/lang/Object; +9 -1: mergeSort +77 -1: (ITK;TV;Ljava/util/HashMap$Node;)Ljava/util/HashMap$TreeNode; +21 -1: sun/nio/cs/ISO_8859_1 +8 -1: DST_MASK +21 -1: Ljava/lang/Throwable; +108 -1: (Ljava/lang/ref/SoftReference;>;I)Ljava/lang/Class$ReflectionData; +32 -1: java/util/Arrays$LegacyMergeSort +59 -1: ()[Ljava/lang/reflect/TypeVariable;>; +16 -1: parseUnsignedInt +36 -1: ([D)Ljava/util/Spliterator$OfDouble; +26 -1: SPECIFY_HANDLER_PERMISSION +13 -1: primitiveType +17 -1: threadStartFailed +21 -1: (J)Ljava/lang/String; +23 -1: setClassAssertionStatus +28 -1: java/util/Hashtable$EntrySet +28 -1: Non-positive maxBytesPerChar +19 -1: getApplicationClass +14 -1: SentinelHolder +15 -1: staticFieldBase +25 -1: setDefaultRequestProperty +66 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedValueTask +8 -1: threadID +9 -1: getFields +15 -1: LineNumberTable +38 -1: java/util/Collections$CheckedSortedSet +14 -1: jdkBuildNumber +6 -1: divide +46 -1: (Ljava/io/BufferedWriter;Ljava/lang/String;Z)V +20 -1: java/lang/Terminator +92 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/lang/String;Ljava/net/URL;Ljava/util/jar/JarEntry;)V +6 -1: force0 +10 -1: getThreads +34 -1: java/util/IllformedLocaleException +115 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/repository/FieldRepository; +9 -1: testFlags +11 -1: getLanguage +36 -1: java/util/function/IntBinaryOperator +12 -1: Suppressed: +10 -1: isMandated +23 -1: MethodAccessorImpl.java +28 -1: (Ljava/util/zip/ZipEntry;)[B +27 -1: Ljava/util/Hashtable$Entry; +5 -1: table +10 -1: Short.java +19 -1: ReferenceQueue.java +8 -1: setTabAt +26 -1: ()Lsun/invoke/empty/Empty; +53 -1: (Ljava/lang/Class;Ljava/lang/String;)Ljava/lang/Enum; +74 -1: (ILjava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$Node; +19 -1: changeParameterType +61 -1: Ljava/util/Map; +23 -1: (Ljava/lang/Object;IF)V +32 -1: (I)Ljava/util/ListIterator; +6 -1: unread +12 -1: isSubclassOf +6 -1: (JJJ)V +3 -1: Key +105 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;ITK;TV;)Ljava/util/HashMap$TreeNode; +14 -1: x-utf-16le-bom +22 -1: ()Ljava/nio/IntBuffer; +104 -1: (Ljava/lang/Class;ILjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle; +21 -1: removeFirstOccurrence +21 -1: sun/misc/DoubleConsts +23 -1: ()Ljava/util/SortedSet; +11 -1: getManEntry +23 -1: URI is not hierarchical +7 -1: replace +16 -1: getDisplayScript +11 -1: ISO_8859-15 +16 -1: permuteArguments +5 -1: (JI)C +41 -1: Error decoding percent encoded characters +22 -1: ([I)Ljava/lang/String; +31 -1: java/lang/management/ThreadInfo +9 -1: useCaches +22 -1: withInternalMemberName +5 -1: (JI)I +5 -1: (JI)J +67 -1: Ljava/lang/Object;Ljava/util/Collection; +95 -1: (Ljava/util/jar/JarFile;[Ljava/security/CodeSource;)Ljava/util/Enumeration; +7 -1: release +56 -1: (Ljava/lang/Object;Ljava/lang/String;)Ljava/lang/String; +5 -1: (JI)V +46 -1: (Ljava/util/Iterator;I)Ljava/util/Spliterator; +18 -1: verifyMemberAccess +9 -1: warning: +23 -1: java/lang/reflect/Field +67 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)V +10 -1: SizePrefix +15 -1: setJavaIOAccess +6 -1: (JI)[B +10 -1: ST_FLUSHED +10 -1: resolution +9 -1: ST_CODING +16 -1: sun/misc/Cleaner +21 -1: (Ljava/lang/Class;)[B +18 -1: WeakReference.java +41 -1: (Ljava/util/List;Ljava/util/Comparator;)V +18 -1: printPropertyValue +3 -1: 813 +22 -1: setRunFinalizersOnExit +4 -1: init +44 -1: ()Ljava/util/Iterator; +3 -1: 819 +12 -1: listIterator +8 -1: , arity= +24 -1: (Ljava/util/ArrayList;)I +49 -1: (IJLjava/io/FileDescriptor;Ljava/lang/Runnable;)V +10 -1: principals +17 -1: x-ISO-2022-CN-CNS +22 -1: (Ljava/lang/Object;F)V +14 -1: setReadTimeout +19 -1: getProtectionDomain +13 -1: pathSeparator +12 -1: getAndSetInt +58 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/util/Locale; +11 -1: setWritable +4 -1: perf +50 -1: ()Ljava/util/concurrent/ConcurrentHashMap; +6 -1: LOCTIM +6 -1: status +11 -1: replaceName +52 -1: (Ljava/lang/CharSequence;II)Ljava/lang/StringBuffer; +9 -1: nextToken +13 -1: dropArguments +20 -1: RECOGNIZED_MODIFIERS +14 -1: getInputStream +9 -1: readFully +25 -1: (CLjava/nio/CharBuffer;)I +24 -1: sun/misc/PathPermissions +10 -1: malformedN +9 -1: n is null +19 -1: instanceof Double: +13 -1: markSupported +26 -1: fromMethodDescriptorString +43 -1: [Ljava/util/concurrent/locks/ReentrantLock; +17 -1: parseUnsignedLong +33 -1: Lsun/misc/URLClassPath$JarLoader; +26 -1: (Ljava/io/OutputStream;I)V +6 -1: L_DASH +17 -1: EmptyNavigableMap +19 -1: CharsetDecoder.java +18 -1: makeDynamicInvoker +12 -1: URLUtil.java +27 -1: ()Ljava/util/Iterator; +9 -1: initTable +11 -1: getFragment +7 -1: isLower +20 -1: getMethodOrFieldType +29 -1: java/util/function/BiFunction +10 -1: access$700 +3 -1: 850 +7 -1: UTC2037 +43 -1: java/util/ArraysParallelSortHelpers$FJShort +9 -1: toSTZTime +10 -1: access$702 +3 -1: 852 +8 -1: hashCode +3 -1: 855 +44 -1: (Ljava/lang/ThreadLocal;Ljava/lang/Object;)V +3 -1: 857 +3 -1: 858 +5 -1: erase +55 -1: ()Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>; +47 -1: (Ljava/util/Iterator;JI)Ljava/util/Spliterator; +38 -1: Ljava/nio/charset/spi/CharsetProvider; +22 -1: can't deserialize enum +13 -1: LF_EX_INVOKER +18 -1: java/text/Collator +18 -1: Zero length string +49 -1: ()Ljava/util/Iterator; +5 -1: amd64 +12 -1: getNameCount +7 -1: inCheck +52 -1: (Ljava/util/concurrent/ConcurrentHashMap$TreeNode;)V +53 -1: (ILjava/lang/CharSequence;II)Ljava/lang/StringBuffer; +21 -1: java/util/WeakHashMap +8 -1: throws +52 -1: (Ljava/util/concurrent/ConcurrentHashMap$TreeNode;)Z +55 -1: Ljava/lang/ref/SoftReference; +16 -1: emptyEnumeration +3 -1: 862 +89 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Object;ILjava/lang/Class;)Ljava/util/List; +3 -1: 866 +55 -1: Lsun/reflect/generics/repository/ConstructorRepository; +35 -1: (Ljava/lang/ref/ReferenceQueue$1;)V +33 -1: java/util/Collections$CheckedList +18 -1: prefetchReadStatic +7 -1: (JI[I)I +78 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;)Ljava/lang/ThreadLocal$ThreadLocalMap; +7 -1: ordinal +22 -1: FilterInputStream.java +26 -1: java/util/zip/ZipConstants +28 -1: JVM cannot find invoker for +43 -1: sun/reflect/generics/parser/SignatureParser +51 -1: (Ljava/lang/invoke/MethodType;[Ljava/lang/Object;)V +73 -1: (Ljava/util/function/ToIntFunction;Ljava/lang/Object;Ljava/lang/Object;)I +17 -1: StringBuffer.java +62 -1: ([Ljava/lang/Object;Ljava/lang/StringBuilder;Ljava/util/Set;)V +6 -1: equals +9 -1: formatter +3 -1: 874 +35 -1: newGetShortIllegalArgumentException +74 -1: (Ljava/nio/CharBuffer;Ljava/nio/ByteBuffer;)Ljava/nio/charset/CoderResult; +3 -1: ucp +60 -1: ([Ljava/lang/ClassValue$Entry;I)Ljava/lang/ClassValue$Entry; +6 -1: create +17 -1: makeReinvokerForm +18 -1: csisolatincyrillic +15 -1: incrementAndGet +24 -1: maybeInstantiateVerifier +33 -1: ()Ljava/nio/channels/FileChannel; +6 -1: class +16 -1: getAnnotatedType +43 -1: (Ljava/lang/reflect/Type;)Ljava/lang/Class; +9 -1: HASH_BITS +12 -1: placeInCache +38 -1: java/util/Collections$SynchronizedList +89 -1: (Ljava/net/URL;Ljava/util/jar/JarFile;Ljava/util/jar/JarEntry;)Ljava/security/CodeSource; +22 -1: (Ljava/lang/String;I)B +20 -1: Ljava/util/TimeZone; +16 -1: sun.java.command +28 -1: java/util/WeakHashMap$Values +10 -1: X-UTF-16BE +22 -1: (Ljava/lang/String;I)I +26 -1: java/nio/DirectCharBufferS +99 -1: (Ljava/lang/String;[BIILjava/lang/ClassLoader;Ljava/security/ProtectionDomain;)Ljava/lang/Class<*>; +22 -1: (Ljava/lang/String;I)J +26 -1: java/nio/DirectCharBufferU +54 -1: (Ljava/util/function/Supplier;)Ljava/lang/ThreadLocal; +21 -1: java/util/AbstractSet +37 -1: (Ljava/lang/String;)Ljava/lang/Short; +36 -1: Ljava/nio/charset/CoderResult$Cache; +22 -1: (Ljava/lang/String;I)S +15 -1: Ljava/util/Map; +59 -1: (Ljava/lang/reflect/Type;)Ljava/lang/reflect/AnnotatedType; +22 -1: (Ljava/lang/String;I)V +10 -1: getAddress +25 -1: java/nio/DirectIntBufferS +11 -1: IMPL_LOOKUP +3 -1: uee +7 -1: addTime +37 -1: sun/security/action/GetPropertyAction +25 -1: java/nio/DirectIntBufferU +21 -1: javaUtilZipFileAccess +34 -1: java/util/Collections$CheckedQueue +11 -1: readResolve +22 -1: (Ljava/lang/String;I)Z +11 -1: findVirtual +63 -1: (Ljava/lang/String;Ljava/lang/String;)Lsun/security/util/Debug; +22 -1: getDeclaredAnnotations +16 -1: Collections.java +18 -1: invalid entry size +49 -1: java/util/concurrent/ConcurrentHashMap$TableStack +32 -1: java/util/AbstractSequentialList +4 -1: int0 +16 -1: MAXIMUM_CAPACITY +53 -1: ()Ljava/util/concurrent/ConcurrentHashMap$KeySetView; +4 -1: int1 +4 -1: int2 +4 -1: int3 +119 -1: (Ljava/lang/Class;Ljava/lang/String;[Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;I)Lsun/reflect/MethodAccessor; +7 -1: variant +39 -1: Lsun/reflect/annotation/AnnotationType; +11 -1: arrayOffset +24 -1: ()Ljava/util/LinkedList; +31 -1: java/lang/ClassCircularityError +17 -1: java/lang/Package +10 -1: ccsid00858 +27 -1: java/io/ExpiringCache$Entry +16 -1: newFieldAccessor +67 -1: (Ljava/lang/Object;Ljava/util/function/Function;)Ljava/lang/Object; +99 -1: Lsun/reflect/generics/repository/GenericDeclRepository; +53 -1: (Ljava/lang/invoke/MethodHandle;[Ljava/lang/Object;)V +53 -1: Ljava/util/concurrent/ConcurrentHashMap$Node; +58 -1: ([TT;)Ljava/util/stream/Stream; +54 -1: (Ljava/lang/CharSequence;Ljava/text/Normalizer$Form;)Z +8 -1: Kerberos +29 -1: ()Ljava/nio/channels/Channel; +12 -1: java_version +45 -1: (Lsun/reflect/DelegatingMethodAccessorImpl;)V +10 -1: canConvert +136 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;)V +26 -1: getDayOfWeekDateOnOrBefore +7 -1: INVALID +10 -1: TERMINATED +41 -1: Ljava/security/cert/CertificateException; +74 -1: (Ljava/lang/String;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/String; +30 -1: [Ljava/lang/invoke/MethodType; +13 -1: getMethodName +7 -1: Factory +34 -1: (Ljava/util/function/BiConsumer;)V +11 -1: unlinkFirst +37 -1: lambda$getDeclaredAnnotationsByType$0 +77 -1: (Ljava/nio/ByteBuffer;ILjava/nio/CharBuffer;II)Ljava/nio/charset/CoderResult; +20 -1: java/util/ArrayDeque +65 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;Ljava/lang/String;J)V +49 -1: (Ljava/util/ArrayDeque;Ljava/util/ArrayDeque$1;)V +22 -1: (J)Ljava/time/Instant; +17 -1: URLClassPath.java +6 -1: 8859_1 +25 -1: stopRemoteManagementAgent +6 -1: 8859_2 +17 -1: containsNullValue +6 -1: 8859_4 +6 -1: 8859_5 +26 -1: (Ljava/nio/ByteBuffer;IC)V +76 -1: (Ljava/lang/Runnable;Ljava/security/AccessControlContext;)Ljava/lang/Thread; +6 -1: 8859_7 +6 -1: 8859_9 +8 -1: setHours +9 -1: File.java +21 -1: isIdentifierIgnorable +5 -1: ([C)I +4 -1: (B)I +10 -1: codesource +77 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;Ljava/security/AccessControlContext;)V +4 -1: (B)J +6 -1: isFair +30 -1: java/lang/NullPointerException +10 -1: IMPL_NAMES +13 -1: Runnable.java +26 -1: Ill-formed extension key: +17 -1: ()[Ljava/io/File; +18 -1: javaSecurityAccess +16 -1: equalsIgnoreCase +4 -1: (B)V +5 -1: ([C)V +25 -1: Ljava/io/FileInputStream; +14 -1: trackJavaUsage +20 -1: Ljava/io/FileSystem; +10 -1: iso_8859_1 +4 -1: (B)Z +30 -1: java/lang/NoClassDefFoundError +152 -1: (Ljava/util/HashMap$TreeNode;Ljava/util/HashMap$TreeNode;)Ljava/util/HashMap$TreeNode; +19 -1: java/lang/Cloneable +55 -1: ([Ljava/lang/Object;Ljava/util/function/IntFunction;I)V +27 -1: (Ljava/nio/ByteBuffer;IJZ)V +21 -1: ()Lsun/misc/JarIndex; +72 -1: ([Ljava/security/CodeSource;)Ljava/util/Enumeration; +64 -1: (Ljava/util/Collection;Ljava/util/Comparator;)Ljava/lang/Object; +20 -1: invalid entry crc-32 +9 -1: BASECOUNT +29 -1: java/security/BasicPermission +52 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/io/File; +7 -1: ([B[B)Z +17 -1: EMPTY_ELEMENTDATA +61 -1: (Ljava/security/PrivilegedExceptionAction;)Ljava/lang/Object; +49 -1: (ILjava/lang/Class;)Ljava/lang/invoke/MethodType; +29 -1: sun/reflect/MagicAccessorImpl +121 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/repository/ConstructorRepository; +6 -1: ([II)I +40 -1: (Ljava/lang/String;I)Ljava/lang/Integer; +25 -1: java.content.handler.pkgs +63 -1: ()Ljava/util/Set;>; +13 -1: parameterList +6 -1: rebind +16 -1: isSuperInterface +6 -1: ([II)V +14 -1: currentRuntime +9 -1: BA_EXISTS +15 -1: END_PUNCTUATION +15 -1: no such method +19 -1: getAndVerifyPackage +4 -1: wrap +24 -1: checkAwtEventQueueAccess +7 -1: ibm-437 +4 -1: open +47 -1: (Ljava/nio/ByteBuffer;[BI)Ljava/nio/ByteBuffer; +21 -1: ADDRESS_BITS_PER_WORD +13 -1: isConstructor +12 -1: getUseCaches +27 -1: sun/util/locale/LocaleUtils +4 -1: koi8 +23 -1: getParameterAnnotations +9 -1: providers +57 -1: ([Ljava/lang/Object;Ljava/util/function/BinaryOperator;)V +24 -1: Lsun/misc/JavaNetAccess; +22 -1: ([J)Ljava/lang/String; +7 -1: p-1022$ +6 -1: isType +63 -1: Ljava/util/Map; +21 -1: pageAlignDirectMemory +18 -1: getManifestDigests +37 -1: [Ljava/lang/reflect/AccessibleObject; +7 -1: decrypt +54 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/util/HashMap; +32 -1: lambda$comparingByKey$bbdbfea9$1 +21 -1: hasGenericInformation +31 -1: java/nio/charset/CharsetEncoder +15 -1: setTargetNormal +3 -1: ulp +18 -1: argumentTypesMatch +12 -1: getDayOfYear +8 -1: closeAll +76 -1: Ljava/lang/ref/SoftReference; +6 -1: concat +9 -1: getLongAt +16 -1: hasBeenFinalized +32 -1: [Ljava/util/Hashtable$Entry<**>; +23 -1: CheckedRandomAccessList +106 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/net/URI; +21 -1: defineClassInPackage. +11 -1: ([III[III)V +8 -1: toZoneId +34 -1: SUBCLASS_IMPLEMENTATION_PERMISSION +55 -1: java/util/concurrent/atomic/AtomicReferenceFieldUpdater +8 -1: isDirect +10 -1: ALL_ACCESS +12 -1: isRegistered +29 -1: ForEachTransformedMappingTask +5 -1: LIJFD +23 -1: (Ljava/util/TimeZone;)V +23 -1: (Ljava/util/TimeZone;)Z +20 -1: java/lang/Appendable +29 -1: Lsun/util/calendar/Gregorian; +9 -1: charValue +8 -1: ONE_HOUR +38 -1: (Ljava/util/Locale;)Ljava/lang/String; +7 -1: script= +10 -1: X-UTF-16LE +7 -1: ENTRIES +6 -1: detach +38 -1: certpath PKIX CertPathBuilder and +14 -1: setLanguageTag +13 -1: isAlphaString +13 -1: interpretName +9 -1: dayOfWeek +88 -1: (Ljava/lang/Class;ZLjava/lang/String;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/List; +91 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;)Ljava/lang/invoke/MethodHandle; +13 -1: addTypeString +17 -1: VectorSpliterator +12 -1: MILLISECONDS +6 -1: CENCOM +10 -1: KeySetView +18 -1: getTargetException +7 -1: H_ALPHA +32 -1: sun/util/locale/BaseLocale$Cache +25 -1: [Ljava/lang/CharSequence; +7 -1: Builder +4 -1: left +19 -1: BootClassPathHolder +12 -1: publicFields +11 -1: windows-437 +9 -1: EMPTY_SET +26 -1: GET_STACK_TRACE_PERMISSION +6 -1: copyOf +14 -1: aliases_IBM737 +9 -1: writeLong +35 -1: (JLjava/util/concurrent/TimeUnit;)Z +70 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction; +22 -1: getAnnotatedReturnType +41 -1: (Ljava/lang/String;[BII)Ljava/lang/Class; +8 -1: ,maxpri= +29 -1: handleParameterNumberMismatch +26 -1: ts timestamping +11 -1: checkListen +10 -1: SourceFile +44 -1: (Ljava/lang/String;)Ljava/util/jar/JarEntry; +17 -1: weakCompareAndSet +9 -1: timestamp +21 -1: (Z)Ljava/lang/String; +12 -1: doneWithMeta +20 -1: makeCollectArguments +52 -1: (JLjava/util/function/BiFunction;)Ljava/lang/Object; +10 -1: searchKeys +48 -1: sun/reflect/SerializationConstructorAccessorImpl +69 -1: (Ljava/lang/reflect/Constructor<*>;)Lsun/reflect/ConstructorAccessor; +19 -1: ()Lsun/misc/Unsafe; +11 -1: deepEquals0 +7 -1: GB18030 +13 -1: ValueIterator +75 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)V +28 -1: java/util/PropertyPermission +6 -1: CENCRC +3 -1: url +3 -1: L_L +19 -1: Certificate too big +33 -1: sun/reflect/DelegatingClassLoader +16 -1: lambda$stream$57 +11 -1: BitSet.java +13 -1: sun/misc/Perf +26 -1: Ljava/util/SimpleTimeZone; +7 -1: (BBBB)I +24 -1: sun/misc/FloatingDecimal +21 -1: sun/util/PreHashedMap +8 -1: utf-16be +11 -1: isInherited +83 -1: (Ljava/util/Properties;Ljava/io/OutputStream;Ljava/lang/String;Ljava/lang/String;)V +52 -1: (Ljava/lang/Class;Ljava/security/ProtectionDomain;)V +11 -1: getDoOutput +18 -1: asVarargsCollector +22 -1: NoSuchMethodError.java +18 -1: getStackTraceDepth +30 -1: (Ljava/io/File;)Ljava/net/URL; +15 -1: CURRENCY_SYMBOL +24 -1: Lsun/misc/JavaNioAccess; +6 -1: NATIVE +22 -1: Lsun/misc/PerfCounter; +63 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesToIntTask +30 -1: less than Character.MIN_RADIX +17 -1: isCallerSensitive +8 -1: shutdown +11 -1: STATE_GREEN +4 -1: next +10 -1: tryPresize +16 -1: CONSTRUCTOR_NAME +3 -1: MAY +21 -1: java.security.manager +20 -1: Lsun/misc/Contended; +16 -1: DISPLAY_LANGUAGE +6 -1: KeySet +9 -1: getScript +3 -1: utc +17 -1: TRACE_INTERPRETER +39 -1: (Ljava/lang/Object;I)Ljava/lang/String; +19 -1: getFieldAtIfLoaded0 +15 -1: methodFilterMap +54 -1: Ljava/util/Map; +45 -1: java/security/cert/Certificate$CertificateRep +43 -1: (Ljava/lang/String;)Lsun/util/calendar/Era; +34 -1: java/security/cert/X509Certificate +19 -1: versionsInitialized +11 -1: isDirectory +14 -1: aliases_IBM775 +38 -1: (Ljava/util/function/Consumer<-TE;>;)V +38 -1: (Ljava/lang/String;)Ljava/util/Locale; +40 -1: (Ljava/lang/String;Z)Lsun/misc/Resource; +14 -1: setDefaultZone +14 -1: highResCounter +78 -1: (Ljava/lang/ClassValue$Version;Ljava/lang/Object;)Ljava/lang/ClassValue$Entry; +16 -1: defaultUseCaches +40 -1: (Ljava/util/zip/ZipFile;)Ljava/util/Map; +24 -1: isSupplementaryCodePoint +15 -1: ISO_8859_1.java +13 -1: multiplyExact +126 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Lsun/util/locale/LocaleExtensions;)Ljava/util/Locale; +8 -1: classMap +8 -1: wildcard +19 -1: getSimpleBinaryName +17 -1: illegal signature +14 -1: == basicType( +17 -1: ZipConstants.java +32 -1: [Ljava/lang/VirtualMachineError; +27 -1: ()Ljava/util/stream/Stream; +24 -1: (Ljava/lang/Exception;)V +21 -1: java/util/Enumeration +13 -1: newSetFromMap +8 -1: getenv.* +20 -1: sun/management/Agent +21 -1: sun/nio/cs/US_ASCII$1 +7 -1: comment +15 -1: appendAuthority +11 -1: hasWrappers +10 -1: dstOffset +24 -1: sun/reflect/ConstantPool +75 -1: (Ljava/util/jar/JarFile;[Ljava/security/CodeSource;)Ljava/util/Enumeration; +52 -1: (Ljava/util/jar/JarFile;)Ljava/util/jar/JarVerifier; +70 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction; +14 -1: previousSetBit +17 -1: AF_GETSTATIC_INIT +15 -1: ArrayDeque.java +7 -1: boolean +25 -1: (I)Ljava/math/BigInteger; +146 -1: (Ljava/lang/ref/ReferenceQueue;>;Ljava/util/concurrent/ConcurrentMap<+Ljava/lang/ref/WeakReference;>;*>;)V +8 -1: getClass +8 -1: user.dir +6 -1: VALUES +5 -1: raise +39 -1: (JLjava/util/function/Consumer<-TV;>;)V +107 -1: Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater; +5 -1: print +8 -1: readChar +55 -1: (JLjava/util/TimeZone;)Lsun/util/calendar/CalendarDate; +56 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysTask +60 -1: Ljava/lang/Number;Ljava/lang/Comparable; +102 -1: (Ljava/util/SortedMap;)Ljava/util/SortedMap; +23 -1: printModifiersIfNonzero +14 -1: getterFunction +15 -1: ISO-10646-UCS-2 +14 -1: canonizeString +13 -1: getTotalSpace +24 -1: synchronizedNavigableSet +100 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;)TT; +4 -1: ioex +24 -1: ()Ljava/nio/FloatBuffer; +14 -1: toBinaryString +7 -1: Segment +34 -1: ()Lsun/misc/JavaUtilZipFileAccess; +17 -1: setTargetVolatile +22 -1: (Ljava/util/List<*>;)V +51 -1: (ILjava/lang/CharSequence;)Ljava/lang/StringBuffer; +22 -1: (Ljava/util/List<*>;)Z +5 -1: (FI)F +11 -1: parseMethod +8 -1: Compiled +19 -1: java/util/SortedMap +7 -1: setByte +12 -1: getFieldType +8 -1: pageSize +14 -1: getCallerClass +9 -1: ensureObj +18 -1: refKindHasReceiver +10 -1: getZoneIds +24 -1: (Ljava/nio/CharBuffer;)I +47 -1: ()Lsun/reflect/generics/parser/SignatureParser; +8 -1: getIndex +24 -1: (Ljava/lang/Thread;TT;)V +18 -1: (Ljava/util/Map;)V +18 -1: (Ljava/util/Map;)Z +6 -1: random +10 -1: putAddress +64 -1: (Ljava/util/function/Consumer<-Ljava/util/Map$Entry;>;)V +24 -1: (Ljava/nio/CharBuffer;)V +8 -1: canCache +24 -1: (Ljava/nio/CharBuffer;)Z +9 -1: getIntAt0 +4 -1: sqrt +8 -1: makeLong +54 -1: ([Ljava/lang/Object;Ljava/util/function/IntFunction;)V +5 -1: (JJ)I +26 -1: javaIOFileDescriptorAccess +5 -1: (JJ)J +15 -1: != basicType: +36 -1: Ljava/lang/ref/ReferenceQueue<-TT;>; +5 -1: words +16 -1: sun.jnu.encoding +32 -1: (Ljava/lang/invoke/LambdaForm;)V +22 -1: ensureClassInitialized +16 -1: Ljava/util/List; +14 -1: varargsInvoker +5 -1: (JJ)V +20 -1: java/util/Properties +12 -1: getImplClass +21 -1: argumentTypesToString +5 -1: (JJ)Z +50 -1: java/util/Collections$SynchronizedRandomAccessList +17 -1: makeWrappedMember +21 -1: UnmodifiableSortedSet +22 -1: (ILjava/lang/Class;Z)V +3 -1: MIT +13 -1: bootClassPath +50 -1: (JLjava/util/function/Function;)Ljava/lang/Object; +74 -1: Ljava/util/HashMap$Node; +45 -1: (Ljava/util/Map$Entry;Ljava/util/Map$Entry;)I +12 -1: advanceProbe +10 -1: encoderFor +14 -1: DataInput.java +16 -1: java/lang/Double +3 -1: 912 +3 -1: 914 +3 -1: abs +3 -1: 915 +13 -1: currentThread +17 -1: ClassDefiner.java +32 -1: sun/misc/Launcher$ExtClassLoader +16 -1: Current state = +12 -1: elementCount +10 -1: unmaskNull +8 -1: csibm857 +32 -1: java/net/UnknownServiceException +10 -1: x-utf-16be +3 -1: acc +37 -1: Ljava/util/List; +23 -1: ([Ljava/lang/Thread;Z)I +17 -1: impliesIgnoreMask +23 -1: getGenericComponentType +51 -1: ()Lsun/reflect/generics/repository/ClassRepository; +34 -1: " not found. Will use interpreter. +38 -1: ()Ljava/security/AccessControlContext; +6 -1: final +8 -1: utf-16le +3 -1: 920 +3 -1: 923 +5 -1: (I)[C +43 -1: (Ljava/nio/ByteOrder;)Ljava/nio/ByteBuffer; +8 -1: csibm862 +34 -1: (Ljava/lang/ref/Reference<+TT;>;)Z +8 -1: csibm866 +20 -1: getParameterizedType +7 -1: (II[C)V +20 -1: [Ljava/lang/Package; +84 -1: (Ljava/lang/String;Ljava/security/ProtectionDomain;)Ljava/security/ProtectionDomain; +28 -1: SynchronizedRandomAccessList +18 -1: sun/misc/VMSupport +61 -1: java/lang/invoke/MethodType$ConcurrentWeakInternSet$WeakEntry +3 -1: add +16 -1: ZipEntryIterator +11 -1: next_target +87 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/CodeSource;)Ljava/lang/Class<*>; +4 -1: amod +12 -1: markedSkipLF +55 -1: java/util/concurrent/ConcurrentHashMap$EntrySpliterator +5 -1: lim= +29 -1: java/security/PermissionsHash +50 -1: (Ljava/lang/CharSequence;II)Ljava/lang/Appendable; +19 -1: makePairwiseConvert +58 -1: (Ljava/lang/ClassValue$Entry;)V +8 -1: contents +11 -1: user.region +17 -1: RandomAccess.java +13 -1: singletonList +13 -1: policy,access +64 -1: Ljava/util/Map; +25 -1: (Ljava/lang/Appendable;)V +19 -1: (Ljava/util/List;)V +43 -1: (Ljava/lang/ClassLoader;Ljava/lang/Class;)V +19 -1: (Ljava/util/List;)Z +15 -1: America/Chicago +25 -1: (II)Ljava/nio/CharBuffer; +12 -1: getDayOfWeek +8 -1: ([BIIZ)V +28 -1: (Ljava/lang/reflect/Field;)I +28 -1: (Ljava/lang/reflect/Field;)J +18 -1: getDeclaringClass0 +11 -1: counterTime +30 -1: (Ljava/util/Collection;)V +28 -1: (Ljava/lang/reflect/Field;)V +31 -1: (IIIILjava/io/FileDescriptor;)V +25 -1: java/net/SocketPermission +20 -1: bad parameter count +18 -1: getHeaderFieldLong +26 -1: GetReflectionFactoryAction +19 -1: MIN_TRANSFER_STRIDE +17 -1: java/nio/Bits$1$1 +7 -1: getSize +33 -1: java/util/function/ToLongFunction +46 -1: (IILjava/lang/String;)Ljava/lang/StringBuffer; +10 -1: access$800 +65 -1: sun/misc/JavaSecurityProtectionDomainAccess$ProtectionDomainCache +26 -1: (Ljava/lang/ClassLoader;)V +25 -1: java/util/IdentityHashMap +26 -1: (Ljava/lang/ClassLoader;)Z +91 -1: (Ljava/util/function/ToIntFunction<-TT;>;)Ljava/util/Comparator; +26 -1: ([CIILjava/lang/String;I)I +12 -1: canonicalize +3 -1: val +8 -1: putCharB +12 -1: UTF_32LE_BOM +60 -1: (Ljava/security/CodeSource;)Ljava/security/ProtectionDomain; +44 -1: (Lsun/misc/SignalHandler;Lsun/misc/Signal;)V +26 -1: (Ljava/util/Enumeration;)V +11 -1: INVALIDATED +8 -1: putCharL +22 -1: (II)Ljava/lang/String; +7 -1: hasNext +5 -1: WRITE +20 -1: MIN_INITIAL_CAPACITY +13 -1: propertyNames +9 -1: Gregorian +13 -1: getExpiration +7 -1: minutes +7 -1: ostream +9 -1: java.lang +17 -1: forceStandardTime +9 -1: initWords +41 -1: java/lang/Thread$UncaughtExceptionHandler +9 -1: theUnsafe +27 -1: ForEachTransformedEntryTask +10 -1: forEncoder +31 -1: needsClassLoaderPermissionCheck +5 -1: ctime +25 -1: ()Ljava/nio/DoubleBuffer; +8 -1: getValue +66 -1: (Lsun/util/locale/BaseLocale$Key;)Lsun/util/locale/BaseLocale$Key; +42 -1: (Ljava/io/InputStream;Ljava/lang/String;)V +6 -1: august +14 -1: compileClasses +13 -1: javaNetAccess +22 -1: interpretWithArguments +4 -1: url: +14 -1: EMPTY_ITERATOR +60 -1: Ljava/util/WeakHashMap; +24 -1: java/util/jar/Attributes +12 -1: getOrDefault +19 -1: Pacific/Guadalcanal +33 -1: ()Ljava/lang/reflect/Constructor; +38 -1: java/util/Collections$UnmodifiableList +13 -1: basicTypeChar +22 -1: (Ljava/lang/String;J)J +14 -1: memberDefaults +42 -1: (Ljava/lang/Class<*>;[Ljava/lang/String;)V +38 -1: (Ljava/util/function/Consumer<-TK;>;)V +16 -1: LF_NEWINVSPECIAL +10 -1: classDepth +28 -1: [Ljava/io/ObjectStreamField; +46 -1: (Ljava/util/Collection;)Ljava/util/Collection; +91 -1: ([Ljava/lang/reflect/Method;Ljava/lang/String;[Ljava/lang/Class;)Ljava/lang/reflect/Method; +11 -1: getLocation +39 -1: (Ljava/lang/Class;[Ljava/lang/Class;Z)V +9 -1: loadTable +55 -1: Directory separator should not appear in library name: +7 -1: setTime +14 -1: getConstructor +4 -1: urls +25 -1: dispatchUncaughtException +77 -1: (ILjava/lang/Object;Ljava/lang/Class<*>;)Ljava/util/HashMap$TreeNode; +8 -1: modCount +8 -1: Opening +6 -1: ENDHDR +4 -1: cnfe +34 -1: DIRECTIONALITY_PARAGRAPH_SEPARATOR +10 -1: Asia/Amman +3 -1: MST +28 -1: DIRECTIONALITY_ARABIC_NUMBER +3 -1: all +4 -1: enum +8 -1: copyWith +12 -1: ([JI[IIJII)I +29 -1: Ljava/lang/annotation/Target; +7 -1: Thread- +14 -1: x-utf-32le-bom +38 -1: (ILjava/lang/management/MemoryUsage;)V +33 -1: Signal already used by VM or OS: +27 -1: (I)Ljava/lang/StringBuffer; +25 -1: java/text/Normalizer$Form +10 -1: x-utf-16le +34 -1: can not access a member of class +27 -1: (Ljava/nio/ByteBuffer;IFZ)V +28 -1: (Ljava/lang/ClassValue<*>;)V +16 -1: INITIAL_CAPACITY +23 -1: DirectMethodHandle.java +18 -1: reduceValuesToLong +41 -1: (Ljava/lang/String;Ljava/lang/Class<*>;)V +6 -1: unwrap +12 -1: threadStatus +5 -1: (DI)D +11 -1: fieldOffset +52 -1: java/util/concurrent/ConcurrentHashMap$EntryIterator +14 -1: ACCESS_EXECUTE +44 -1: (Ljava/nio/ByteBuffer;)Ljava/nio/CharBuffer; +29 -1: ([Ljava/lang/ThreadGroup;IZ)I +18 -1: LocalVariableTable +17 -1: ConstantPool.java +26 -1: (Ljava/nio/ByteBuffer;ID)V +4 -1: (C)B +3 -1: and +4 -1: head +126 -1: (Ljava/lang/reflect/GenericDeclaration;Lsun/reflect/generics/scope/Scope;)Lsun/reflect/generics/factory/CoreReflectionFactory; +4 -1: (C)C +16 -1: Pacific/Auckland +7 -1: Thread[ +5 -1: ([D)I +4 -1: (C)I +98 -1: ([Ljava/lang/reflect/Constructor;)[Ljava/lang/reflect/Constructor; +11 -1: fileHandler +30 -1: DIRECTIONALITY_NONSPACING_MARK +10 -1: (this Map) +14 -1: malformedCache +5 -1: ([D)V +4 -1: (C)V +26 -1: getUnicodeLocaleAttributes +4 -1: (C)Z +81 -1: (JLjava/util/function/ToLongBiFunction;JLjava/util/function/LongBinaryOperator;)J +46 -1: [Ljava/util/concurrent/ConcurrentHashMap$Node; +20 -1: Max. Heap Size: +24 -1: Ljava/lang/reflect/Type; +13 -1: EmptyIterator +8 -1: allocate +7 -1: FLUSHED +8 -1: exitVM.* +59 -1: (Ljava/lang/String;)Lsun/util/locale/InternalLocaleBuilder; +19 -1: reduceEntriesToLong +15 -1: getISOLanguages +13 -1: CONSTANT_ZERO +23 -1: (I)Ljava/util/Iterator; +96 -1: Ljava/util/AbstractMap;Ljava/util/Map; +11 -1: isSynthetic +7 -1: lineBuf +30 -1: java/lang/annotation/Inherited +65 -1: Ljava/lang/Object;Ljava/lang/Iterable; +35 -1: (Ljava/lang/String;)[Ljava/io/File; +27 -1: java/security/cert/CertPath +26 -1: startRemoteManagementAgent +9 -1: shiftLeft +5 -1: stack +42 -1: (Ljava/lang/Class<*>;[Ljava/lang/Object;)V +11 -1: CheckedList +10 -1: replaceAll +86 -1: (Ljava/util/HashMap$TreeNode;Ljava/util/HashMap$TreeNode;)Ljava/util/HashMap$TreeNode; +24 -1: (I)Ljava/nio/CharBuffer; +13 -1: image/vnd.fpx +15 -1: iso_8859-1:1987 +19 -1: (Ljava/lang/Long;)I +22 -1: sun/misc/SignalHandler +15 -1: ifModifiedSince +42 -1: (Ljava/lang/Class;)Ljava/lang/ClassLoader; +105 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/String;ILjava/lang/Class;I[Ljava/lang/invoke/MemberName;)I +22 -1: Negative timeout value +38 -1: Ljava/io/UnsupportedEncodingException; +11 -1: removeRange +13 -1: Compiler.java +6 -1: Sorter +8 -1: aliasSet +10 -1: UNASSIGNED +34 -1: lambda$comparingByValue$1065357e$1 +34 -1: ()Ljava/lang/Class$AnnotationData; +25 -1: sun/misc/Launcher$Factory +15 -1: getLongVolatile +8 -1: vmloader +10 -1: unicodebig +10 -1: closeables +31 -1: JavaIOFileDescriptorAccess.java +7 -1: static +3 -1: arg +21 -1: library can't be null +42 -1: java/util/ArraysParallelSortHelpers$FJByte +22 -1: getDeclaringExecutable +19 -1: runFinalizersOnExit +20 -1: simpleTimeZoneParams +13 -1: Modifier.java +14 -1: pkcs11keystore +6 -1: shared +30 -1: java/net/MalformedURLException +26 -1: ()[Lsun/util/calendar/Era; +13 -1: x-MS950-HKSCS +10 -1: relativize +40 -1: (Ljava/lang/String;JJ)Ljava/lang/String; +31 -1: java/util/HashMap$ValueIterator +29 -1: MODIFY_THREADGROUP_PERMISSION +38 -1: (Ljava/lang/String;)Ljava/lang/Object; +7 -1: destroy +37 -1: (Ljava/util/List;)[Ljava/lang/String; +18 -1: (Ljava/io/File;Z)V +32 -1: Ljava/util/HashMap$Node; +18 -1: interfaceModifiers +34 -1: java/util/LinkedList$LLSpliterator +7 -1: REF_??? +23 -1: java/net/ContentHandler +20 -1: +17 -1: [Ljava/lang/Byte; +6 -1: exitVM +3 -1: att +27 -1: sun/nio/cs/UTF_16BE$Encoder +6 -1: exists +28 -1: Ljava/util/Collection<+TE;>; +48 -1: (Ljava/lang/CharSequence;)Ljava/lang/Appendable; +6 -1: getMap +52 -1: ([Ljava/lang/Class;I)Ljava/lang/reflect/Constructor; +11 -1: stackTrace[ +21 -1: slowCheckMemberAccess +33 -1: ReflectiveOperationException.java +9 -1: versionId +56 -1: Wrong number of parameters in MethodParameters attribute +14 -1: isLowSurrogate +8 -1: csPCp852 +16 -1: copyConstructors +25 -1: ()Ljava/util/Spliterator; +9 -1: closeLock +17 -1: readUnsignedShort +7 -1: 8859_13 +7 -1: 8859_15 +13 -1: TARGET_OFFSET +26 -1: (Ljava/util/Hashtable;IZ)V +44 -1: (Ljava/nio/CharBuffer;)Ljava/nio/CharBuffer; +46 -1: (Ljava/lang/reflect/Type;)Ljava/lang/Class<*>; +25 -1: DEFAULT_CONCURRENCY_LEVEL +36 -1: Ljava/util/List; +29 -1: sun.nio.PageAlignDirectMemory +37 -1: (Ljava/lang/Class;I)Ljava/lang/Class; +12 -1: encryptBlock +8 -1: parentOf +5 -1: H_HEX +11 -1: getFloatAt0 +24 -1: VirtualMachineError.java +18 -1: getDeclaredClasses +59 -1: (Ljava/lang/AbstractStringBuilder;)Ljava/lang/StringBuffer; +42 -1: (Ljava/util/List;>;)[C +37 -1: (Ljava/lang/String;)Ljava/lang/Float; +13 -1: Iterator.java +25 -1: (Ljava/io/PrintStream;I)V +9 -1: getObject +19 -1: [Ljava/lang/String; +7 -1: SIZECTL +11 -1: isUnderflow +27 -1: sun.nio.MaxDirectMemorySize +21 -1: isNonPublicProxyClass +13 -1: toCalendarDOW +9 -1: Type.java +14 -1: aliases_IBM850 +17 -1: emptyNavigableMap +14 -1: aliases_IBM852 +14 -1: aliases_IBM855 +14 -1: aliases_IBM857 +14 -1: aliases_IBM858 +15 -1: iso_8859-4:1988 +13 -1: UnicodeScript +8 -1: getCharB +17 -1: constructorMethod +27 -1: java/util/function/Function +20 -1: getProtectionDomain0 +8 -1: getCharL +32 -1: ([Ljava/io/File;)[Ljava/net/URL; +51 -1: (Ljava/lang/Class;Z)Ljava/lang/invoke/MethodHandle; +7 -1: getenv. +5 -1: stale +14 -1: aliases_IBM862 +32 -1: java/util/spi/LocaleNameProvider +14 -1: aliases_IBM866 +51 -1: ([Ljava/lang/Class;)Ljava/lang/reflect/Constructor; +6 -1: CENDSK +36 -1: java/util/Comparators$NullComparator +34 -1: UnsafeStaticFieldAccessorImpl.java +17 -1: staticFieldOffset +12 -1: prefetchRead +4 -1: help +34 -1: (Ljava/util/concurrent/TimeUnit;)J +8 -1: getChars +19 -1: java/lang/Throwable +34 -1: Annotation Type:\n Member types: +55 -1: (Ljava/lang/Class<*>;Ljava/security/ProtectionDomain;)V +14 -1: aliases_IBM874 +17 -1: getDisplayVariant +24 -1: Ljava/net/NetPermission; +15 -1: jvmMinorVersion +11 -1: subSequence +3 -1: x86 +6 -1: double +14 -1: checkSlotCount +20 -1: java/net/InetAddress +14 -1: Principal.java +8 -1: $,;:@&=+ +17 -1: ByteBuffered.java +21 -1: sun.misc.Perf.getPerf +11 -1: finishEntry +27 -1: sun.timezone.ids.oldmapping +26 -1: (ZLjava/io/OutputStream;)V +41 -1: (Ljava/lang/String;Z)Ljava/lang/Class<*>; +32 -1: generateSerializationConstructor +6 -1: Value +40 -1: (Ljava/lang/String;Ljava/lang/String;Z)V +16 -1: previousClearBit +7 -1: theProp +51 -1: (Ljava/io/OutputStream;Ljava/nio/charset/Charset;)V +39 -1: com.sun.javafx.application.LauncherImpl +21 -1: URLStreamHandler.java +4 -1: in +14 -1: BIT_INDEX_MASK +125 -1: (Ljava/util/Comparator<-TK;>;)Ljava/util/Comparator;>; +49 -1: (Ljava/util/Set;Ljava/lang/Class;)Ljava/util/Set; +10 -1: scaleValue +27 -1: (Ljava/nio/ByteBuffer;IDZ)V +78 -1: (Ljava/util/Collection;[Ljava/lang/reflect/Field;)V +53 -1: (I)Ljava/util/Enumeration; +38 -1: java/lang/IncompatibleClassChangeError +60 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsTask +23 -1: not a method or field: +35 -1: Ljava/nio/BufferUnderflowException; +4 -1: i386 +13 -1: US_ASCII.java +80 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)Ljava/lang/reflect/AnnotatedType; +21 -1: initializeSystemClass +6 -1: ([CI)I +18 -1: getBooleanProperty +35 -1: java/util/function/ToDoubleFunction +37 -1: (Ljava/lang/String;)Ljava/lang/Class; +28 -1: MapReduceEntriesToDoubleTask +38 -1: java/util/LinkedHashMap$LinkedEntrySet +8 -1: copySign +6 -1: ([CI)V +55 -1: sun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule +12 -1: parseBoolean +3 -1: NET +3 -1: NEW +6 -1: Values +17 -1: getJavaLangAccess +9 -1: LocaleKey +3 -1: :-1 +30 -1: (Ljava/io/ObjectInputStream;)V +3 -1: NFC +3 -1: NFD +18 -1: SIMPLIFIED_CHINESE +28 -1: ()Ljava/lang/reflect/Method; +9 -1: localInit +37 -1: sun/util/locale/LocaleSyntaxException +15 -1: LambdaForm.java +5 -1: rtype +8 -1: field " +50 -1: (Ljava/lang/Class;Ljava/lang/ref/ReferenceQueue;)V +80 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B)V +36 -1: java/lang/invoke/MethodHandleNatives +22 -1: (Ljava/util/Map<**>;)Z +22 -1: Ljava/lang/Class; +7 -1: SubList +14 -1: connect,accept +19 -1: declaredAnnotations +38 -1: Ljava/lang/ThreadLocal$ThreadLocalMap; +11 -1: isSpaceChar +10 -1: offerFirst +20 -1: sun/nio/ByteBuffered +17 -1: packageDefinition +7 -1: trigger +35 -1: [Ljava/lang/invoke/LambdaForm$Name; +19 -1: sun.stdout.encoding +5 -1: start +26 -1: (Ljava/util/HashMap;IIII)V +65 -1: (JLjava/util/function/Consumer<-Ljava/util/Map$Entry;>;)V +6 -1: LOCVER +3 -1: :// +42 -1: (CLjava/lang/Class<*>;Ljava/lang/Object;)Z +6 -1: friday +45 -1: sun/reflect/DelegatingConstructorAccessorImpl +15 -1: iso_8859-7:1987 +15 -1: newCalendarDate +24 -1: getAnnotatedReceiverType +32 -1: java/util/NoSuchElementException +50 -1: (Ljava/util/NavigableSet;)Ljava/util/NavigableSet; +26 -1: java/text/SimpleDateFormat +16 -1: threadInitNumber +55 -1: (TT;)Ljava/util/Spliterator; +23 -1: (Ljava/lang/Object;)TT; +3 1: bar +37 -1: getFunctionalInterfaceMethodSignature +5 -1: state +39 -1: [Ljava/lang/reflect/GenericDeclaration; +22 -1: sun/net/ProgressSource +13 -1: LLSpliterator +93 -1: Ljava/lang/Object;Ljava/util/Enumeration;Ljava/util/Iterator; +5 -1: JAPAN +11 -1: SPACE_TOTAL +20 -1: CharsetProvider.java +12 -1: CR_UNDERFLOW +7 -1: ITALIAN +11 -1: getCallerPD +13 -1: isMemberClass +38 -1: (Ljava/util/function/Consumer<-TT;>;)V +18 -1: malformedForLength +14 -1: ReflectionData +34 -1: (BZI)Ljava/lang/invoke/LambdaForm; +16 -1: forPrimitiveType +31 -1: field found in java.lang.Class +60 -1: (Ljava/lang/Void;Ljava/lang/ThreadGroup;Ljava/lang/String;)V +18 -1: DescendingIterator +25 -1: (IZLjava/lang/Runnable;)V +35 -1: ()[Ljava/lang/reflect/TypeVariable; +3 -1: bcp +23 -1: (Ljava/lang/Object;)TV; +25 -1: setDefaultAssertionStatus +10 -1: ([BIIIII)V +150 -1: (Ljava/util/concurrent/ConcurrentHashMap$Node;)Ljava/util/concurrent/ConcurrentHashMap$Node; +14 -1: Inherited: +17 -1: fileTimeToWinTime +7 -1: ([BI)[B +26 -1: java/io/OutputStreamWriter +58 -1: (Ljava/util/ListIterator<+TT;>;I)TT; +39 -1: sun/reflect/annotation/AnnotationParser +71 -1: (Ljava/nio/file/Path;Ljava/lang/String;)Ljava/nio/file/DirectoryStream; +47 -1: Ljava/util/concurrent/locks/ReentrantLock$Sync; +44 -1: (Ljava/util/Collection;[Ljava/lang/Object;)Z +43 -1: ([ILjava/util/function/IntBinaryOperator;)V +29 -1: reverseAllValidSurrogatePairs +20 -1: Ljava/nio/file/Path; +20 -1: getGenericSignature0 +42 -1: (Ljava/lang/String;Ljava/lang/Class<*>;Z)V +8 -1: manEntry +64 -1: (Ljava/lang/String;)Ljava/util/Enumeration; +36 -1: newGetDoubleIllegalArgumentException +63 -1: (Ljava/util/Collection;Ljava/lang/Class;)Ljava/util/Collection; +30 -1: Ergonomics Machine Class: +40 -1: ()Ljava/util/Map; +50 -1: (Ljava/lang/StringBuffer;)Ljava/lang/StringBuffer; +30 -1: CHECK_MEMBER_ACCESS_PERMISSION +22 -1: (Ljava/lang/Boolean;)I +10 -1: V_Variable +68 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedMappingTask +61 -1: (Ljava/lang/String;IILjava/lang/String;)Ljava/nio/ByteBuffer; +21 -1: accessClassInPackage. +44 -1: java/util/WeakHashMap$WeakHashMapSpliterator +11 -1: nextElement +9 -1: separator +48 -1: java/util/zip/ZipFile$ZipFileInflaterInputStream +44 -1: java/security/UnresolvedPermissionCollection +10 -1: access$900 +44 -1: java/util/ArraysParallelSortHelpers$FJDouble +84 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodHandle; +52 -1: (Ljava/lang/ref/Finalizer;)Ljava/lang/ref/Finalizer; +19 -1: getDeclaredMethods0 +29 -1: (IJ)Ljava/lang/StringBuilder; +11 -1: Member.java +61 -1: (Ljava/lang/String;ZJJ)Ljava/lang/management/MemoryPoolMBean; +35 -1: java/lang/AssertionStatusDirectives +23 -1: Declaring class is null +56 -1: (Ljava/lang/Class;Ljava/lang/Object;Ljava/lang/Object;)I +12 -1: java/io/File +41 -1: java/util/ConcurrentModificationException +47 -1: (Ljava/lang/CharSequence;)Ljava/nio/CharBuffer; +19 -1: parameterClassCache +8 -1: US_ASCII +15 -1: tryMonitorEnter +22 -1: Ljava/util/Collection; +67 -1: (Lsun/misc/Signal;Lsun/misc/SignalHandler;)Lsun/misc/SignalHandler; +27 -1: (Lsun/misc/JavaNioAccess;)V +9 -1: DigitOnes +5 -1: write +31 -1: NF_internalMemberNameEnsureInit +18 -1: comparableClassFor +20 -1: defineAnonymousClass +49 -1: (Ljava/io/InputStream;Lsun/net/ProgressSource;J)V +31 -1: java/lang/NumberFormatException +17 -1: remainderUnsigned +62 -1: ;>()Ljava/util/Comparator; +4 -1: Kind +20 -1: (Ljava/lang/Short;)I +8 -1: OfDouble +51 -1: ([Ljava/lang/Object;Ljava/lang/invoke/MethodType;)Z +22 -1: [Ljava/util/Map$Entry; +13 -1: instanceClass +29 -1: ()Ljava/lang/SecurityManager; +12 -1: isUnmappable +17 -1: getAllStackTraces +19 -1: LinkedValueIterator +7 -1: isDigit +10 -1: rangeCheck +89 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Ljava/util/List; +13 -1: getMethodType +21 -1: FileOutputStream.java +22 -1: ()Ljava/text/Collator; +64 -1: (Ljava/security/PrivilegedAction;)TT; +15 -1: defaultTimeZone +14 -1: emptySortedMap +35 -1: (Ljava/util/function/IntConsumer;)V +45 -1: java/util/Collections$CheckedRandomAccessList +11 -1: getPriority +7 -1: signals +6 -1: Subset +15 -1: invokeInterface +16 -1: nameRefsAreLegal +38 -1: (Ljava/lang/Object;)Ljava/lang/Object; +37 -1: Ljava/util/Collections$EmptyIterator; +9 -1: Perf.java +20 -1: java/math/BigInteger +38 -1: java/util/WeakHashMap$ValueSpliterator +71 -1: (Ljava/nio/charset/CodingErrorAction;)Ljava/nio/charset/CharsetEncoder; +50 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Object;)V +21 -1: [Ljava/lang/Class<*>; +13 -1: getProperties +63 -1: (Ljava/lang/Class<*>;[B[Ljava/lang/Object;)Ljava/lang/Class<*>; +65 -1: (Ljava/util/Set;>;)[Ljava/lang/reflect/Field; +21 -1: sun/util/calendar/Era +21 -1: Ljava/nio/CharBuffer; +23 -1: (Ljava/lang/Object;JS)V +24 -1: oracle/jrockit/jfr/VMJFR +15 -1: access allowed +34 -1: ()Lsun/util/calendar/CalendarDate; +97 -1: (Ljava/security/PrivilegedExceptionAction;Ljava/security/AccessControlContext;)Ljava/lang/Object; +44 -1: ([Ljava/lang/Object;[Ljava/lang/Object;III)V +48 -1: (Ljava/util/Collection;I)Ljava/util/Spliterator; +11 -1: SimpleEntry +63 -1: (Ljava/net/URL;Ljava/net/URLStreamHandler;Ljava/util/HashMap;)V +8 -1: putFloat +20 -1: linkToCallSiteMethod +8 -1: invokers +35 -1: (J)Lsun/util/calendar/BaseCalendar; +6 -1: FRENCH +26 -1: getRawParameterAnnotations +9 -1: wordIndex +29 -1: JNI_COPY_FROM_ARRAY_THRESHOLD +20 -1: sun/nio/cs/Surrogate +48 -1: (Lsun/misc/JavaSecurityProtectionDomainAccess;)V +45 -1: (Ljava/lang/ThreadLocal;Ljava/lang/Object;I)V +3 -1: NST +14 -1: getHeaderField +27 -1: (Ljava/util/jar/JarFile;Z)V +10 -1: findNative +38 -1: The following can be used with access: +29 -1: convertCertArrayToSignerArray +4 -1: .DSA +12 -1: dependencies +12 -1: SYNCHRONIZED +14 -1: x-euc-jp-linux +28 -1: URLStreamHandlerFactory.java +11 -1: checkPtypes +68 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)V +13 -1: addDayOfMonth +10 -1: isAncestor +16 -1: entryDislocation +12 -1: tableSizeFor +29 -1: (ID)Ljava/lang/StringBuilder; +19 -1: getLastRuleInstance +24 -1: getGenericParameterTypes +8 -1: ,offset= +37 -1: (Ljava/net/URL;Ljava/lang/String;II)V +13 -1: UTF_16LE.java +12 -1: setTimestamp +31 -1: AtomicReferenceFieldUpdaterImpl +6 -1: L_URIC +4 -1: (D)D +14 -1: DeqSpliterator +13 -1: LF_INVVIRTUAL +171 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/String;)Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater; +4 -1: (D)I +22 -1: Ljava/lang/Class; +4 -1: (D)J +196 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object; +13 -1: ,transitions= +30 -1: (Lsun/net/www/MessageHeader;)I +4 -1: (D)V +12 -1: segmentShift +4 -1: (D)Z +14 -1: Reference.java +26 -1: [Ljava/lang/reflect/Field; +26 -1: java/nio/DirectByteBufferR +31 -1: lambda$thenComparing$36697e65$1 +30 -1: (Lsun/net/www/MessageHeader;)V +55 -1: No java.nio.charset.StandardCharsets instances for you! +59 -1: (Ljava/lang/Class<*>;Ljava/lang/Object;Ljava/lang/Object;)I +19 -1: thenComparingDouble +31 -1: ()Ljava/lang/invoke/LambdaForm; +9 -1: getMillis +21 -1: StandardCharsets.java +15 -1: postDefineClass +8 -1: getExtra +3 -1: box +10 -1: nextSetBit +27 -1: java/util/ArrayList$SubList +43 -1: (Ljava/util/concurrent/ConcurrentHashMap;)V +52 -1: (Lsun/misc/URLClassPath;)Ljava/net/URLStreamHandler; +7 -1: putLong +40 -1: ;>([TT;)V +8 -1: ([DII)[D +8 -1: ([SIIS)I +8 -1: argument +12 -1: linkCallSite +56 -1: Ljava/lang/ref/WeakReference; +15 -1: returnSlotCount +68 -1: (Ljava/lang/String;[Ljava/lang/Class<*>;Z)Ljava/lang/reflect/Method; +20 -1: defaultDisplayLocale +21 -1: (Ljava/util/Vector;)V +49 -1: (Lsun/reflect/generics/visitor/TypeTreeVisitor;)V +12 -1: isAlphabetic +5 -1: perms +13 -1: dosToJavaTime +8 -1: ([SIIS)V +7 -1: valueOf +27 -1: Ljava/util/LinkedList$Node; +41 -1: (Ljava/lang/String;I)Ljava/lang/Class<*>; +38 -1: ()Ljava/nio/charset/CodingErrorAction; +4 -1: MASK +5 -1: Field +101 -1: (Ljava/lang/Class;Ljava/nio/ByteBuffer;Lsun/reflect/ConstantPool;Ljava/lang/Class;)Ljava/lang/Object; +56 -1: (Ljava/lang/String;Lsun/misc/Resource;)Ljava/lang/Class; +9 -1: SURROGATE +72 -1: (Ljava/lang/invoke/DirectMethodHandle$StaticAccessor;)Ljava/lang/Object; +19 -1: PARAMETER_MODIFIERS +48 -1: ([Ljava/lang/Object;II)Ljava/util/stream/Stream; +56 -1: (TK;TV;Ljava/util/function/BiFunction<-TV;-TV;+TV;>;)TV; +118 -1: (JLjava/util/function/BiFunction<-TK;-TV;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU; +29 -1: (Lsun/nio/ch/Interruptible;)V +45 -1: Ljava/lang/ref/Reference; +17 -1: isHeldExclusively +3 -1: NYI +15 -1: getByteVolatile +20 -1: compareAndSwapObject +29 -1: (Z)[Ljava/lang/reflect/Field; +7 -1: ([SII)V +13 -1: toLanguageTag +18 -1: StreamEncoder.java +25 -1: (IF)Ljava/nio/ByteBuffer; +18 -1: afterNodeInsertion +11 -1: accessOrder +60 -1: Lsun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget; +20 -1: META-INF/MANIFEST.MF +18 -1: getSuperInterfaces +26 -1: (Ljava/nio/ByteBuffer;IZ)C +26 -1: (Ljava/nio/ByteBuffer;IZ)D +9 -1: PROTECTED +18 -1: not visible from +26 -1: java/lang/RuntimeException +26 -1: (Ljava/nio/ByteBuffer;IZ)F +20 -1: java/net/FileNameMap +15 -1: insertArguments +8 -1: diagprop +26 -1: (Ljava/nio/ByteBuffer;IZ)I +26 -1: (Ljava/nio/ByteBuffer;IZ)J +20 -1: createContentHandler +11 -1: getProtocol +26 -1: (Ljava/nio/ByteBuffer;IZ)S +33 -1: Ljava/lang/NoSuchMethodException; +19 -1: entry name too long +40 -1: java/util/jar/JarVerifier$VerifierStream +6 -1: server +7 -1: OCTOBER +26 -1: sun/invoke/util/VerifyType +6 -1: domain +9 -1: getUnsafe +5 -1: ([Z)I +4 -1: cons +42 -1: ()Ljava/lang/ReflectiveOperationException; +4 -1: byte +29 -1: java/util/function/BiConsumer +24 -1: getJavaUtilZipFileAccess +37 -1: ([Ljava/lang/Object;)Ljava/util/List; +27 -1: timeout can not be negative +62 -1: Ljava/util/Map; +16 -1: getOurStackTrace +34 -1: (J)Ljava/lang/ref/Reference<+TT;>; +50 -1: Lsun/reflect/generics/repository/MethodRepository; +20 -1: MIN_BYTE_BUFFER_SIZE +3 -1: buf +13 -1: getAttributes +6 -1: GERMAN +38 -1: java/security/NoSuchAlgorithmException +20 -1: Direct buffer memory +6 -1: (IIZ)V +27 -1: JVMTI_THREAD_STATE_RUNNABLE +26 -1: [Ljava/io/File$PathStatus; +36 -1: (Ljava/util/List;Ljava/lang/Class;)V +13 -1: JarIndex.java +34 -1: java/lang/Character$CharacterCache +8 -1: csIBM857 +10 -1: LineReader +28 -1: Ljava/lang/RuntimeException; +30 -1: ()Ljava/util/Enumeration; +12 -1: getSeparator +124 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;)Ljava/lang/Object; +97 -1: Ljava/util/Map;>; +21 -1: ConstantCallSite.java +40 -1: sun/util/locale/provider/LocaleResources +101 -1: ;>(Ljava/util/function/Function<-TT;+TU;>;)Ljava/util/Comparator; +4 -1: copy +23 -1: sun/security/util/Debug +10 -1: isAbsolute +34 -1: (Ljava/lang/invoke/MethodHandle;)V +34 -1: (Ljava/lang/invoke/MethodHandle;)Z +48 -1: ()[Ljava/util/concurrent/ConcurrentHashMap$Node; +34 -1: (Lsun/reflect/LangReflectAccess;)V +8 -1: csIBM862 +8 -1: csIBM866 +64 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysToDoubleTask +39 -1: No java.util.Objects instances for you! +68 -1: (Ljava/util/PrimitiveIterator$OfInt;JI)Ljava/util/Spliterator$OfInt; +19 -1: Illegal class name +24 -1: uncaughtExceptionHandler +12 -1: runFinalizer +23 -1: java/io/FileInputStream +41 -1: (Ljava/lang/Class<*>;Ljava/lang/String;)V +98 -1: (Ljava/util/HashMap$Node;Ljava/util/HashMap$Node;)Ljava/util/HashMap$Node; +30 -1: java/nio/charset/CoderResult$1 +20 -1: SourceDebugExtension +30 -1: java/nio/charset/CoderResult$2 +69 -1: ([Ljava/security/ProtectionDomain;[Ljava/security/ProtectionDomain;)Z +14 -1: 1.8.0-internal +16 -1: ReduceValuesTask +13 -1: toLowerString +14 -1: newPrintStream +13 -1: unicodelittle +19 -1: getClassLoadingLock +9 -1: DigitTens +80 -1: (Ljava/lang/Class<*>;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodType; +12 -1: sun_eu_greek +21 -1: getBootstrapClassPath +9 -1: volatile +15 -1: UnmodifiableMap +21 -1: enumConstantDirectory +10 -1: getContent +4 -1: cosh +74 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/util/Locale; +11 -1: ([JII[JII)V +28 -1: java/lang/reflect/Executable +17 -1: MapReduceKeysTask +6 -1: isOpen +17 -1: AnnotationDefault +17 -1: Already connected +27 -1: (Lsun/misc/JavaNetAccess;)V +34 -1: ([BILjava/nio/charset/Charset;Z)[B +55 -1: Ljava/lang/invoke/DirectMethodHandle$EnsureInitialized; +8 -1: Set.java +10 -1: DEAD_ENTRY +7 -1: nextInt +3 -1: wtb +23 -1: java/util/Collections$1 +86 -1: (Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/visitor/Reifier; +23 -1: java/util/Collections$2 +23 -1: java/util/Collections$3 +18 -1: DoubleCumulateTask +22 -1: skip value is negative +85 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/lang/String;)Lsun/nio/cs/StreamDecoder; +5 -1: \\[\\]$ +34 -1: Ljava/util/NoSuchElementException; +3 -1: NaN +30 -1: sun/util/calendar/CalendarDate +10 -1: V_Constant +20 -1: java/lang/Comparable +9 -1: text/html +20 -1: -9223372036854775808 +20 -1: DataInputStream.java +20 -1: Member defaults: +35 -1: Ljava/lang/ref/ReferenceQueue$Lock; +8 -1: getBytes +17 -1: CodePointIterator +11 -1: Signal.java +19 -1: javaHomePrefixCache +12 -1: replaceFirst +37 -1: Ljava/lang/IndexOutOfBoundsException; +39 -1: (Ljava/lang/String;ZI)Ljava/lang/Class; +21 -1: initSystemClassLoader +28 -1: America/Indiana/Indianapolis +47 -1: (Ljava/security/Permission;Ljava/lang/Object;)V +27 -1: java/net/URISyntaxException +21 -1: createSecurityManager +7 -1: suspend +12 -1: L_UNRESERVED +17 -1: checkMemberAccess +12 -1: CoreCounters +19 -1: java/net/HttpCookie +8 -1: isGetter +17 -1: setDaylightSaving +27 -1: java.launcher.javafx.error1 +53 -1: java/util/concurrent/ConcurrentHashMap$CollectionView +16 -1: readUnsignedByte +47 -1: (Ljava/lang/String;)Ljava/net/URLStreamHandler; +40 -1: (Z)[Ljava/lang/reflect/Constructor; +14 -1: javaLangAccess +5 -1: apply +8 -1: getFloat +15 -1: getD3DAvailable +25 -1: startLocalManagementAgent +7 -1: RUNTIME +22 -1: LocalVariableTypeTable +8 -1: doOutput +16 -1: CheckedSortedSet +10 -1: zoneOffset +64 -1: (Ljava/security/Permission;)Ljava/security/PermissionCollection; +13 -1: hasUnresolved +13 -1: user.language +11 -1: getDoubleAt +14 -1: getQueueLength +37 -1: java/nio/DirectByteBuffer$Deallocator +6 -1: ASHIFT +9 -1: checkPath +80 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;Ljava/lang/Class;)V +6 -1: CENEXT +16 -1: doubleToLongBits +11 -1: copyToArray +9 -1: copyField +36 -1: ()Lsun/util/calendar/Gregorian$Date; +53 -1: (ILjava/lang/Object;)Ljava/util/HashMap$Node; +44 -1: (TK;TV;Ljava/lang/ref/ReferenceQueue;)V +35 -1: java/util/Collections$EmptyIterator +38 -1: sealing violation: can't seal package +37 -1: (Ljava/util/Queue;Ljava/lang/Class;)V +129 -1: (Ljava/lang/Class<*>;Ljava/lang/String;[Ljava/lang/Class<*>;Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B[B)V +18 -1: HashMapSpliterator +8 -1: putShort +23 -1: (Ljava/lang/Object;II)V +7 -1: GERMANY +13 -1: toTitleString +102 -1: (Ljava/util/ArrayPrefixHelpers$CumulateTask;Ljava/util/function/BinaryOperator;[Ljava/lang/Object;II)V +44 -1: ([Ljava/lang/Object;)Ljava/util/Spliterator; +6 -1: unused +25 -1: java/net/URLClassLoader$1 +25 -1: java/net/URLClassLoader$2 +25 -1: java/net/URLClassLoader$3 +25 -1: java/net/URLClassLoader$4 +12 -1: getFixedDate +25 -1: java/net/URLClassLoader$5 +4 -1: time +25 -1: java/net/URLClassLoader$6 +25 -1: java/net/URLClassLoader$7 +14 -1: historicalName +12 -1: normalizeKey +13 -1: MIN_SURROGATE +41 -1: java/nio/charset/CharacterCodingException +18 -1: java/lang/Iterable +8 -1: ([JII)[J +103 -1: Ljava/util/Map;Ljava/lang/annotation/Annotation;>; +18 -1: putBooleanVolatile +5 -1: Entry +11 -1: CounterCell +12 -1: monitorEnter +10 -1: skipBuffer +15 -1: hasMoreElements +24 -1: newIllegalStateException +24 -1: Ljava/lang/LinkageError; +12 -1: getEntryFlag +44 -1: (Ljava/lang/Throwable$PrintStreamOrWriter;)V +18 -1: java/nio/IntBuffer +17 -1: jdk_minor_version +28 -1: DIRECTIONALITY_RIGHT_TO_LEFT +15 -1: getAndSetObject +7 -1: sizeCtl +15 -1: Ljava/util/Set; +32 -1: (I)Ljava/lang/invoke/LambdaForm; +16 -1: runFinalization0 +30 -1: Ljava/lang/reflect/Executable; +15 -1: compareUnsigned +5 -1: nkeys +31 -1: Ljava/nio/channels/FileChannel; +40 -1: sun/reflect/generics/tree/ClassSignature +22 -1: (Ljava/lang/Object;I)B +22 -1: (Ljava/lang/Object;I)C +22 -1: (Ljava/lang/Object;I)D +7 -1: JANUARY +30 -1: newGetIllegalArgumentException +22 -1: (Ljava/lang/Object;I)F +22 -1: (Ljava/lang/Object;I)I +22 -1: (Ljava/lang/Object;I)J +28 -1: generateNamedFunctionInvoker +38 -1: (Ljava/lang/String;)Ljava/time/ZoneId; +19 -1: lambda$codePoints$2 +4 -1: Null +7 -1: setEras +15 -1: lambda$chars$15 +14 -1: CollectionView +24 -1: (C)Ljava/io/PrintStream; +22 -1: (Ljava/lang/Object;I)S +96 -1: (Ljava/security/AccessControlContext;Lsun/security/util/Debug;Ljava/security/ProtectionDomain;)V +17 -1: getJulianCalendar +22 -1: (Ljava/lang/Object;I)V +17 -1: getMethodAccessor +9 -1: not owner +35 -1: java/lang/reflect/ParameterizedType +15 -1: ValueCollection +22 -1: (Ljava/lang/Object;I)Z +4 -1: utf8 +5 -1: CHINA +9 -1: sprintf0d +18 -1: java/nio/file/Path +35 -1: DIRECTIONALITY_RIGHT_TO_LEFT_ARABIC +30 -1: URI has an authority component +43 -1: (Ljava/lang/Object;)Ljava/util/Spliterator; +15 -1: +62 -1: (Lsun/util/locale/BaseLocale$Key;)Lsun/util/locale/BaseLocale; +6 -1: ([ZZ)V +10 -1: getContext +12 -1: content-type +99 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/ref/ReferenceQueue;ILjava/util/WeakHashMap$Entry;)V +51 -1: (Ljava/util/concurrent/ConcurrentHashMap;)V +27 -1: Invalid constant pool index +20 -1: getUnicodeLocaleType +43 -1: Ljava/nio/charset/CharacterCodingException; +113 -1: (Ljava/net/URL;Ljava/net/URLStreamHandler;Ljava/util/HashMap;)V +56 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/util/Locale; +24 -1: Lsun/misc/SignalHandler; +8 -1: readlink +125 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind<*>;[Ljava/nio/file/WatchEvent$Modifier;)Ljava/nio/file/WatchKey; +11 -1: initStatics +15 -1: unmappableCache +13 -1: fixMethodType +25 -1: sun/net/www/MessageHeader +3 -1: cdt +27 -1: Ljava/util/Locale$Category; +59 -1: (ILjava/lang/Object;Ljava/lang/Object;ZZ)Ljava/lang/Object; +8 -1: Accessor +14 -1: mapLibraryName +54 -1: (Lsun/misc/URLClassPath$JarLoader;)Lsun/misc/JarIndex; +24 -1: ZoneOffsetTransitionRule +7 -1: getChar +3 -1: cee +25 -1: MapReduceValuesToLongTask +20 -1: declaredPublicFields +44 -1: (Ljava/lang/ClassLoader;Ljava/lang/String;)J +13 -1: removeElement +20 -1: Ljava/nio/ByteOrder; +8 -1: parallel +67 -1: (Ljava/lang/reflect/Constructor;Lsun/reflect/ConstructorAccessor;)V +22 -1: java/util/zip/ZipCoder +8 -1: ([ZIIZ)V +45 -1: (Ljava/lang/String;Ljava/lang/CharSequence;)Z +8 -1: february +40 -1: java/util/zip/ZipFile$ZipFileInputStream +47 -1: java/nio/charset/Charset$ExtendedProviderHolder +13 -1: IEEEremainder +15 -1: sun/misc/Perf$1 +9 -1: abstract +20 -1: ()Ljava/time/ZoneId; +7 -1: ONE_DAY +92 -1: (Ljava/util/concurrent/ConcurrentHashMap$Node;)Ljava/util/concurrent/ConcurrentHashMap$Node; +45 -1: (Ljava/util/ListIterator;I)Ljava/lang/Object; +16 -1: Buffer size <= 0 +9 -1: checkName +11 -1: getJarEntry +20 -1: Replacement too long +53 -1: (Ljava/lang/String;)Ljava/nio/charset/CharsetDecoder; +12 -1: isWhitespace +15 -1: csISOLatinGreek +70 -1: (Ljava/lang/reflect/Constructor<*>;Lsun/reflect/ConstructorAccessor;)V +20 -1: TypeAnnotationTarget +3 -1: No +27 -1: Lsun/reflect/FieldAccessor; +12 -1: doPrivileged +83 -1: (JLjava/util/function/ToIntFunction<-TV;>;ILjava/util/function/IntBinaryOperator;)I +60 -1: (Ljava/nio/file/attribute/FileTime;)Ljava/util/zip/ZipEntry; +11 -1: changeEntry +18 -1: MessageHeader.java +51 -1: ([Ljava/lang/String;Ljava/util/Map;)Ljava/util/Map; +9 -1: castEntry +16 -1: ACCESS_MODIFIERS +11 -1: newInstance +24 -1: lastIndexOfSupplementary +13 -1: JZENTRY_EXTRA +5 -1: LONGS +7 -1: domain +16 -1: protocolPathProp +21 -1: java/util/Hashtable$1 +10 -1: isSameDate +23 -1: (I)Ljava/nio/file/Path; +33 -1: java/util/PrimitiveIterator$OfInt +7 -1: ([II)[I +8 -1: variant= +29 -1: (Ljava/util/Collection<*>;Z)Z +38 -1: already loaded in another classloader +10 -1: setSeconds +9 -1: makeShort +59 -1: ClassLoader.findLibrary failed to return an absolute path: +26 -1: java/util/jar/JarException +9 -1: setCharAt +13 -1: initCauseFrom +13 -1: val$fieldName +18 -1: MIN_HIGH_SURROGATE +60 -1: (Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;)B +25 -1: getDayOfWeekFromFixedDate +10 -1: maybeReBox +9 -1: getHandle +60 -1: (Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;)I +59 -1: ([Ljava/lang/Class<*>;)Ljava/lang/reflect/Constructor; +3 -1: cis +11 -1: getIssuerDN +9 -1: codebase= +80 -1: (ILjava/lang/invoke/BoundMethodHandle$SpeciesData;)Ljava/lang/invoke/LambdaForm; +29 -1: addThreadDumpForSynchronizers +6 -1: FRANCE +77 -1: ([TU;ILjava/lang/Class<+[TT;>;)[TT; +45 -1: ()Ljava/util/List; +16 -1: putFloatVolatile +34 -1: (Ljava/lang/Class;)Ljava/util/Map; +28 -1: ()Ljava/security/Permission; +28 -1: (Ljava/lang/CharSequence;I)I +51 -1: ()Ljava/util/Enumeration; +25 -1: (II)Ljava/nio/ByteBuffer; +20 -1: BasicPermission.java +5 -1: isNaN +48 -1: (Ljava/lang/Throwable;)Ljava/lang/InternalError; +10 -1: ONE_MINUTE +55 -1: (Ljava/lang/invoke/DirectMethodHandle$StaticAccessor;)J +13 -1: DAYS_IN_MONTH +7 -1: domains +10 -1: isUnshared +58 -1: Ljava/lang/Number;Ljava/lang/Comparable; +47 -1: (Ljava/util/List;)Ljava/security/cert/CertPath; +28 -1: ()Ljava/util/Enumeration<*>; +34 -1: sun/misc/Launcher$ExtClassLoader$1 +22 -1: (CLjava/lang/Object;)Z +64 -1: Ljava/lang/ref/WeakReference; +7 -1: ENGLISH +27 -1: (Ljava/util/zip/Inflater;)V +24 -1: makeArrayElementAccessor +72 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType; +48 -1: (Ljava/util/jar/JarFile;)Ljava/util/Enumeration; +48 -1: (Ljava/lang/Class;)Ljava/lang/invoke/MethodType; +15 -1: getNthDayOfWeek +16 -1: printHelpMessage +15 -1: getAbsoluteFile +9 -1: OPEN_READ +19 -1: willGMTOffsetChange +28 -1: (Ljava/util/LinkedHashMap;)V +37 -1: java/security/AllPermissionCollection +5 -1: [id=" +34 -1: java/lang/invoke/BoundMethodHandle +31 -1: ()Ljava/security/cert/CertPath; +50 -1: java/util/ArraysParallelSortHelpers$FJShort$Sorter +14 -1: StaticAccessor +22 -1: synchronizedCollection +53 -1: ([Ljava/io/File;)Ljava/security/AccessControlContext; +37 -1: (Ljava/lang/Class;Ljava/lang/Class;)Z +14 -1: codePointCount +13 -1: is param at +37 -1: Ljava/lang/invoke/MemberName$Factory; +20 -1: annotationDataOffset +31 -1: protocol doesn't support output +11 -1: hostAddress +12 -1: ,dstSavings= +35 -1: java.lang.Integer.IntegerCache.high +15 -1: ParallelLoaders +48 -1: (Ljava/util/Locale;)Lsun/util/locale/BaseLocale; +8 -1: getSize0 +22 -1: checkCreateClassLoader +8 -1: transfer +32 -1: (Lsun/misc/JavaSecurityAccess;)V +26 -1: ()Ljava/net/URLConnection; +3 -1: cmp +9 -1: setMillis +34 -1: sun/util/calendar/AbstractCalendar +19 -1: getDirectBufferPool +7 -1: ([FII)V +28 -1: ([C)Ljava/lang/StringBuffer; +54 -1: (Ljava/lang/Class<*>;)Ljava/security/ProtectionDomain; +26 -1: (Ljava/nio/ByteBuffer;IF)V +11 -1: discardMark +71 -1: (Ljava/lang/Class;)Lsun/util/locale/provider/LocaleServiceProviderPool; +30 -1: java/io/UTFDataFormatException +53 -1: (Ljava/nio/CharBuffer;)Ljava/nio/charset/CoderResult; +48 -1: java/util/concurrent/ConcurrentHashMap$Traverser +5 -1: ([F)I +37 -1: (IC)Ljava/lang/AbstractStringBuilder; +27 -1: Ljava/util/jar/JarVerifier; +22 -1: java/util/Spliterators +32 -1: java/lang/invoke/MutableCallSite +20 -1: java/io/Serializable +5 -1: ([F)V +35 -1: (Ljava/security/ProtectionDomain;)V +33 -1: ()Ljava/lang/ref/Reference<+TT;>; +10 -1: unlinkLast +6 -1: (JSZ)V +8 -1: isStatic +14 -1: subclassAudits +23 -1: (Ljava/lang/String;)TT; +17 -1: java.awt.headless +9 -1: +39 -1: Lsun/util/locale/LocaleSyntaxException; +8 -1: location +3 -1: cos +27 -1: createGarbageCollectorMBean +20 -1: MAX_MH_INVOKER_ARITY +75 -1: (Ljava/nio/ByteBuffer;Ljava/nio/CharBuffer;Z)Ljava/nio/charset/CoderResult; +14 -1: Cloneable.java +50 -1: (Lsun/reflect/DelegatingConstructorAccessorImpl;)V +26 -1: sun/nio/ch/FileChannelImpl +51 -1: (Ljava/lang/Class;Ljava/lang/reflect/Constructor;)V +18 -1: Unknown byte order +28 -1: ()[Lsun/invoke/util/Wrapper; +21 -1: getReadClassBytesTime +64 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodTypeForm; +11 -1: setDelegate +20 -1: (Ljava/util/List;)[C +7 -1: usemmap +22 -1: (CC)Ljava/lang/String; +34 -1: sun/invoke/util/BytecodeDescriptor +21 -1: getJavaSecurityAccess +53 -1: (Ljava/nio/ByteBuffer;)Ljava/nio/charset/CoderResult; +7 -1: ibm-737 +19 -1: (Ljava/lang/Enum;)I +4 -1: rint +11 -1: Constructor +9 -1: arraycopy +35 -1: ([D)Ljava/util/stream/DoubleStream; +13 -1: comparingLong +40 -1: Ljava/lang/Object; +23 -1: OutputStreamWriter.java +8 -1: getShort +17 -1: CLASSPATH_LASTOCC +13 -1: createNewFile +14 -1: internalValues +34 -1: Ljava/lang/IllegalAccessException; +23 -1: (JILjava/lang/Object;)V +27 -1: sun.misc.URLClassPath.debug +45 -1: [Ljava/lang/ThreadLocal$ThreadLocalMap$Entry; +35 -1: ()Lsun/reflect/ConstructorAccessor; +12 -1: classEnabled +23 -1: cachedFixedDateNextJan1 +48 -1: (Ljava/util/Locale$LocaleKey;)Ljava/util/Locale; +26 -1: (Ljava/lang/ThreadGroup;)V +7 -1: setErr0 +6 -1: CENFLG +26 -1: (Ljava/lang/ThreadGroup;)Z +18 -1: sun/misc/MetaIndex +3 -1: crc +34 -1: (Z)Ljava/lang/invoke/MethodHandle; +12 -1: replaceNames +15 -1: java/util/Stack +57 -1: Ljava/util/Vector; +89 -1: (JLjava/util/function/ToDoubleFunction<-TV;>;DLjava/util/function/DoubleBinaryOperator;)D +24 -1: permission can't be null +22 -1: Unable to connect to: +44 -1: (Ljava/nio/ByteBuffer;)Ljava/nio/ByteBuffer; +14 -1: floatToIntBits +11 -1: getLastRule +6 -1: EXTCRC +26 -1: java/net/InetSocketAddress +36 -1: (Lsun/misc/URLClassPath$JarLoader;)V +27 3: sun/launcher/LauncherHelper +8 -1: ecma-118 +49 -1: (Ljava/net/URL;Ljava/lang/String;)[Ljava/net/URL; +13 -1: hashCodeValue +5 -1: CESU8 +21 -1: appendVmSelectMessage +13 -1: bindImmediate +12 -1: closeLoaders +16 -1: emptySpliterator +28 -1: (J)Ljava/time/LocalDateTime; +22 -1: [Ljava/lang/Character; +5 -1: certs +6 -1: (null) +25 -1: java/io/ObjectInputStream +27 -1: ([Ljava/lang/ThreadGroup;)I +3 -1: cst +3 -1: csu +20 -1: java/nio/ShortBuffer +53 -1: (Ljava/lang/ClassValue;Ljava/lang/ClassValue$Entry;)V +4 -1: (Z)I +24 -1: Ljava/io/FileDescriptor; +6 -1: cclass +10 -1: , profile +39 -1: (Ljava/lang/String;)Ljava/lang/Process; +4 -1: (Z)V +5 -1: toURI +24 -1: ConstructorAccessor.java +5 -1: toURL +18 -1: addAllIfNotPresent +4 -1: (Z)Z +5 -1: parse +11 -1: isPrimitive +42 -1: (Ljava/io/File;)Ljava/lang/ProcessBuilder; +36 -1: (Ljava/util/Date;)Ljava/lang/String; +23 -1: getFormalTypeParameters +13 -1: Resource.java +7 -1: ibm-775 +6 -1: isEnum +24 -1: setJavaUtilZipFileAccess +21 -1: \t[CIRCULAR REFERENCE: +51 -1: (Ljava/lang/CharSequence;)Ljava/util/regex/Matcher; +24 -1: (I)Ljava/nio/ByteBuffer; +53 -1: sun/reflect/generics/repository/GenericDeclRepository +3 -1: xor +17 -1: invokeBasicMethod +27 -1: java/lang/invoke/LambdaForm +99 -1: (Ljava/util/jar/Manifest;Ljava/util/jar/JarEntry;Ljava/io/InputStream;Ljava/util/jar/JarVerifier;)V +46 -1: Lsun/reflect/generics/factory/GenericsFactory; +37 -1: sun/misc/Launcher$BootClassPathHolder +10 -1: BindCaller +24 -1: java/lang/reflect/Member +32 -1: java/lang/management/ThreadState +5 -1: (IB)V +21 -1: RuntimeException.java +5 -1: ended +17 -1: java/util/TreeSet +7 -1: : no !/ +16 -1: java/util/Vector +9 -1: nextAfter +22 -1: Ljava/lang/Deprecated; +20 -1: requestedCharsetName +37 -1: ([JIII)Ljava/util/Spliterator$OfLong; +14 -1: internArgument +11 -1: getTimeZone +10 -1: isValidKey +11 -1: LAST_RESULT +43 -1: sun/reflect/annotation/TypeAnnotationParser +13 -1: encodedInPath +52 -1: (Ljava/security/PrivilegedAction;)Ljava/lang/Object; +4 -1: LL_L +34 -1: java/nio/charset/CodingErrorAction +10 -1: copyFields +11 -1: getConstant +9 -1: threshold +13 -1: aliases_UTF_8 +27 -1: (Ljava/util/ArrayDeque;II)V +29 -1: Ljava/lang/ref/SoftReference; +19 -1: indexedBinarySearch +11 -1: containsKey +81 -1: ([Ljava/lang/ClassValue$Entry;Ljava/lang/ClassValue;)Ljava/lang/ClassValue$Entry; +86 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class<*>;II)Ljava/lang/invoke/MethodHandle; +15 -1: cannot convert +25 -1: getSystemResourceAsStream +46 -1: (Ljava/util/Properties;)Ljava/util/Properties; +12 -1: reverseOrder +16 -1: getSystemPackage +8 -1: ([SII)[S +19 -1: makeAccessException +100 -1: (JLjava/util/function/Function<-TK;+TU;>;Ljava/util/function/Consumer<-TU;>;)V +39 -1: ([Ljava/lang/Class;I)[Ljava/lang/Class; +19 -1: Ljava/lang/Boolean; +6 -1: Hidden +47 -1: java/lang/invoke/MethodHandleImpl$ArrayAccessor +5 -1: APRIL +8 -1: emptySet +11 -1: getCombiner +58 -1: (Ljava/lang/String;I[Ljava/lang/invoke/LambdaForm$Name;I)V +24 -1: java.system.class.loader +14 -1: Can't handle: +16 -1: isNullConversion +38 -1: ()Ljava/util/HashMap$TreeNode; +29 -1: referenceKindIsConsistentWith +11 -1: flushBuffer +8 -1: putField +27 -1: ()Ljava/security/PublicKey; +53 -1: ()Ljava/util/stream/Stream; +10 -1: pathToURLs +26 -1: throwIllegalStateException +10 -1: markedChar +14 -1: isNativeMethod +36 -1: (I)Ljava/lang/AbstractStringBuilder; +54 -1: java/util/concurrent/ConcurrentHashMap$ReservationNode +45 -1: Lsun/misc/JavaSecurityProtectionDomainAccess; +62 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;Ljava/lang/Object;I)V +7 -1: subList +8 -1: UTF_32BE +6 -1: U_None +50 -1: sun/reflect/generics/repository/AbstractRepository +62 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;Ljava/lang/Object;I)Z +43 -1: sun/net/www/protocol/file/FileURLConnection +13 -1: setZoneOffset +43 -1: Underlying input stream returned zero bytes +54 -1: [a-zA-Z_$][a-zA-Z0-9_$]*([.][a-zA-Z_$][a-zA-Z0-9_$]*)* +13 -1: containsValue +44 -1: (Ljava/nio/CharBuffer;)Ljava/nio/ByteBuffer; +25 -1: isNullReferenceConversion +38 -1: Ljava/util/Vector; +6 -1: toFile +7 -1: getSlot +17 -1: (Ljava/net/URI;)V +32 -1: java.security.cert.Certificate: +24 -1: ()Lsun/misc/PerfCounter; +11 -1: Asia/Hebron +16 -1: createMemoryPool +10 -1: addToCache +29 -1: Ljava/lang/invoke/DontInline; +39 -1: java/lang/ref/Finalizer$FinalizerThread +58 -1: (Ljava/lang/Class;)Lsun/reflect/generics/scope/ClassScope; +20 -1: getBooleanAttributes +15 -1: parallelLockMap +34 -1: java/util/Vector$VectorSpliterator +21 -1: createMemoryPoolMBean +15 -1: no content-type +41 -1: Couldn't find 3-letter language code for +5 -1: slash +34 -1: Ljava/lang/annotation/ElementType; +8 -1: isSetter +26 -1: (ZLjava/lang/String;JJJZ)V +6 -1: GMT_ID +73 -1: ()[Ljava/lang/reflect/TypeVariable;>; +56 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/lang/Object; +32 -1: (Ljava/util/Set;)Ljava/util/Set; +4 -1: stop +62 -1: (Ljava/lang/String;IILjava/lang/String;I)Ljava/nio/ByteBuffer; +11 -1: genericInfo +11 -1: listToArray +26 -1: ()Ljava/util/jar/Manifest; +13 -1: putOrderedInt +5 -1: flush +13 -1: ArrayAccessor +4 -1: Name +95 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;[Ljava/util/concurrent/ConcurrentHashMap$Node;)V +68 -1: (Ljava/lang/Class;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle; +23 -1: java/lang/ref/Reference +37 -1: (Ljava/nio/file/attribute/FileTime;)J +14 -1: MIN_CODE_POINT +9 -1: ISO8859-1 +9 -1: ISO8859-2 +9 -1: ISO8859-5 +34 -1: ([CILjava/nio/charset/Charset;Z)[C +9 -1: ISO8859-9 +9 -1: getUTF8At +12 -1: java/net/URI +67 -1: (Ljava/io/DataInput;Ljava/lang/String;)Lsun/util/calendar/ZoneInfo; +22 -1: ListCompositionPattern +67 -1: (Ljava/lang/String;[BIILjava/security/CodeSource;)Ljava/lang/Class; +3 1: xxx +12 -1: java/net/URL +27 -1: Can't overwrite cause with +30 -1: sun/util/locale/BaseLocale$Key +22 -1: forkSecondaryFinalizer +23 -1: java/security/Principal +8 -1: makeSite +17 -1: NEGATIVE_INFINITY +12 -1: addUnstarted +12 -1: internalForm +9 -1: cellsBusy +23 -1: (Ljava/lang/Object;IJ)V +13 -1: getParameters +6 -1: H_PATH +10 -1: L_REG_NAME +139 -1: Ljava/util/AbstractMap;Ljava/util/Map;Ljava/lang/Cloneable;Ljava/io/Serializable; +6 -1: latin0 +10 -1: addSeconds +6 -1: latin1 +6 -1: latin2 +6 -1: latin4 +6 -1: latin5 +17 -1: getWaitingThreads +6 -1: latin9 +21 -1: java/util/Comparators +10 -1: trimToSize +96 -1: (Ljava/util/Collection;Ljava/lang/Object;)Ljava/util/Collection; +43 -1: ([JLjava/util/function/IntToLongFunction;)V +23 -1: GET_COMBINER_PERMISSION +20 -1: lambda$replaceAll$14 +5 -1: KOREA +20 -1: getJvmSpecialVersion +9 -1: dumpStack +16 -1: CACHE_LOAD_LIMIT +43 -1: GSS LoginConfigImpl debugging +26 -1: (DLjava/lang/Appendable;)V +8 -1: forName0 +35 -1: java/lang/ClassLoader$NativeLibrary +46 -1: java/util/concurrent/ConcurrentHashMap$Segment +24 -1: getDeclaredAnnotationMap +89 -1: java/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl$1 +20 -1: java_runtime_version +26 -1: java/util/stream/IntStream +16 -1: Ljava/io/Writer; +69 -1: ()Ljava/util/SortedMap; +15 -1: getClassLoader0 +6 -1: x86_64 +11 -1: isInterface +15 -1: MODIFIER_SYMBOL +44 -1: Note: Separate multiple options with a comma +9 -1: recursive +19 -1: java/nio/CharBuffer +8 -1: capacity +17 -1: validateMainClass +50 -1: (Ljava/util/Set;Ljava/lang/Object;)Ljava/util/Set; +22 -1: (Ljava/lang/Object;J)B +22 -1: (Ljava/lang/Object;J)C +22 -1: (Ljava/lang/Object;J)D +17 -1: not a method type +22 -1: (Ljava/lang/Object;J)F +5 -1: count +32 -1: AtomicReferenceFieldUpdater.java +22 -1: (Ljava/lang/Object;J)I +14 -1: methodAccessor +22 -1: (Ljava/lang/Object;J)J +7 -1: isError +51 -1: (Ljava/nio/Buffer;II)Ljava/nio/charset/CoderResult; +53 -1: (BZLjava/lang/Class<*>;)Ljava/lang/invoke/LambdaForm; +25 -1: +5 -1: [pos= +14 -1: lambda$chars$1 +9 -1: CELLVALUE +16 -1: haveLeftoverChar +22 -1: ([Ljava/lang/String;)V +32 -1: java/lang/InstantiationException +7 -1: SIG_IGN +13 -1: ZipUtils.java +50 -1: Ljava/lang/ref/ReferenceQueue; +22 -1: (Ljava/lang/Object;J)S +69 -1: Ljava/util/HashMap; +16 -1: newInternalError +22 -1: (Ljava/lang/Object;J)V +9 -1: ABBR_MASK +5 -1: array +22 -1: (Ljava/lang/Object;J)Z +13 -1: FilteringMode +30 -1: java/util/stream/StreamSupport +19 -1: retrieveDisplayName +56 -1: (Ljava/util/TimeZone;)Lsun/util/calendar/Gregorian$Date; +10 -1: val$values +9 -1: normalize +28 -1: (II)Ljava/lang/CharSequence; +16 -1: serialVersionUID +7 -1: getPath +25 -1: (ILjava/lang/Class<*>;Z)V +13 -1: thenComparing +51 -1: (Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle; +36 -1: ()[Ljava/lang/annotation/Annotation; +14 -1: MetaIndex.java +8 -1: identity +15 -1: findSystemClass +24 -1: privateGetDeclaredFields +27 -1: java/lang/ref/SoftReference +19 -1: useCanonPrefixCache +3 -1: dec +3 -1: PLT +8 -1: UTF_32LE +17 -1: java/util/HashMap +12 -1: toEpochMilli +9 -1: intStream +11 -1: Caused by: +31 -1: java/nio/charset/CharsetDecoder +30 -1: is being checked +11 -1: parseHeader +25 -1: ACCUMULATED_DAYS_IN_MONTH +34 -1: newGetByteIllegalArgumentException +21 -1: checkPropertiesAccess +13 -1: StackMapTable +8 -1: addCount +51 -1: (Ljava/lang/invoke/MethodHandle;)Ljava/lang/String; +9 -1: authority +15 -1: iso-10646-ucs-2 +6 -1: SUNDAY +22 -1: LocalGregorianCalendar +9 -1: listRoots +32 -1: Lsun/reflect/generics/tree/Tree; +38 -1: [Ljava/util/WeakHashMap$Entry; +11 -1: nativeOrder +5 -1: long0 +5 -1: long1 +5 -1: long2 +5 -1: long3 +17 -1: capacityIncrement +5 -1: long4 +97 -1: (Ljava/lang/String;Ljava/lang/invoke/MethodType;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName; +31 -1: Ljava/lang/CharacterDataLatin1; +5 -1: long5 +5 -1: long6 +5 -1: long7 +17 -1: reduceValuesToInt +13 -1: package2certs +13 -1: isTypeVisible +30 -1: java/lang/ref/PhantomReference +47 -1: ()Ljava/util/stream/Stream; +9 -1: longValue +3 -1: PNT +10 -1: storeToXML +10 -1: getMethod0 +12 -1: constantZero +7 -1: promise +116 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/repository/MethodRepository; +32 -1: DIRECTIONALITY_SEGMENT_SEPARATOR +9 -1: byteOrder +9 -1: isPromise +4 -1: isOn +6 -1: LOCCRC +10 -1: setDefault +9 -1: setHandle +15 -1: java/nio/Buffer +37 -1: (Ljava/lang/String;I)Ljava/lang/Long; +10 -1: Float.java +12 -1: showSettings +27 -1: (Ljava/io/FileDescriptor;)I +27 -1: (Ljava/io/FileDescriptor;)J +21 -1: java/util/Spliterator +22 -1: CodingErrorAction.java +11 -1: isMalformed +27 -1: java/util/PrimitiveIterator +15 -1: THROW_EXCEPTION +15 -1: copyToCharArray +26 -1: ()Ljava/util/jar/JarEntry; +27 -1: (Ljava/io/FileDescriptor;)V +11 -1: getEncoding +48 -1: (Ljava/lang/ThreadLocal<*>;Ljava/lang/Object;I)V +17 -1: java.runtime.name +28 -1: (Lsun/invoke/util/Wrapper;)Z +20 -1: annotationTypeOffset +27 -1: (J)Ljava/lang/StringBuffer; +15 -1: METHOD_RECEIVER +10 -1: startEntry +29 -1: (I)Ljava/lang/reflect/Member; +7 -1: setOut0 +10 -1: getMethods +26 -1: ()Lsun/misc/JavaNioAccess; +18 -1: linkToTargetMethod +8 -1: INSTANCE +3 -1: dir +41 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;)V +9 -1: unboxCast +58 -1: (TT;)Lsun/invoke/empty/Empty;^TT; +12 -1: java.version +50 -1: (Ljava/io/InputStream;Ljava/nio/charset/Charset;)V +32 2: sun/net/www/protocol/jar/Handler +20 -1: java/lang/Compiler$1 +9 -1: LongCache +14 -1: FILL_THRESHOLD +22 -1: getRawClassAnnotations +9 -1: (JI[CII)I +13 -1: hasMoreTokens +13 -1: getSuperclass +3 -1: PRC +12 -1: MAX_PRIORITY +14 -1: checkCacheLoad +7 -1: lowMask +8 -1: LM_CLASS +7 -1: initIDs +27 -1: Ljava/util/Collection; +3 -1: yes +3 -1: PRT +91 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/LambdaForm; +27 -1: ()Lsun/security/util/Debug; +8 -1: VM start +9 -1: setMemory +7 -1: getName +10 -1: findSignal +19 -1: startsWithLocHeader +37 -1: java/util/Collections$SynchronizedMap +51 -1: (ICLjava/lang/Object;)Ljava/lang/invoke/LambdaForm; +62 -1: (Ljava/util/Locale;)Lsun/util/locale/provider/LocaleResources; +17 -1: lastParameterType +9 -1: NO_PTYPES +116 -1: ([Ljava/lang/ClassValue$Entry<*>;Ljava/lang/ClassValue;)Ljava/lang/ClassValue$Entry; +18 -1: DisplayNamePattern +8 -1: getField +5 -1: flags +3 -1: PST +17 -1: annotationDefault +18 -1: java/nio/ByteOrder +8 -1: highMask +6 -1: ascii7 +29 -1: getGregorianYearFromFixedDate +125 -1: (Ljava/lang/String;[Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;)V +8 -1: =Lambda( +29 -1: Ljava/util/WeakHashMap$Entry; +18 -1: multiValueIterator +74 -1: Ljava/util/LinkedHashMap; +13 -1: CONV_OP_LIMIT +6 -1: sclSet +81 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/util/jar/JarFile;)Ljava/util/jar/JarFile; +14 -1: appendFragment +46 -1: java/util/Collections$SynchronizedNavigableMap +36 -1: application/x-java-serialized-object +13 -1: setNativeName +53 -1: java/util/concurrent/ConcurrentHashMap$ForwardingNode +16 -1: setJavaAWTAccess +30 -1: methodHandleInvokeLinkerMethod +15 -1: reduceKeysToInt +20 -1: ensureCapacityHelper +23 -1: createFileURLConnection +12 -1: d3dAvailable +69 -1: (Ljava/lang/Object;Ljava/lang/invoke/MethodHandle;)Ljava/lang/String; +49 -1: java/util/ArraysParallelSortHelpers$FJLong$Sorter +21 -1: explicitCastArguments +24 -1: JAVAFX_LAUNCH_MODE_CLASS +9 -1: invoke_MT +18 -1: ensureMemberAccess +74 -1: (Ljava/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject;)I +36 -1: java/nio/charset/spi/CharsetProvider +23 -1: (Ljava/lang/String;II)V +14 -1: initProperties +4 -1: (F)F +35 -1: [[Ljava/lang/annotation/Annotation; +4 -1: (F)I +106 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Comparable;Ljava/lang/CharSequence; +46 -1: java/lang/invoke/BoundMethodHandle$SpeciesData +74 -1: (Ljava/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject;)Z +24 -1: java.launcher.opt.header +37 -1: ([Ljava/security/ProtectionDomain;Z)V +10 -1: lineBuffer +7 -1: ibm-813 +9 -1: isBuiltin +4 -1: (F)V +7 -1: ibm-819 +9 -1: H_ESCAPED +4 -1: (F)Z +20 -1: suppressedExceptions +12 -1: UTF-32LE-BOM +19 -1: CalendarSystem.java +8 -1: readOnly +81 -1: (JLjava/util/function/Function;Ljava/util/function/BiFunction;)Ljava/lang/Object; +32 -1: sun/misc/Launcher$AppClassLoader +78 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Comparable; +17 -1: [Ljava/lang/Enum; +41 -1: java/util/Collections$CheckedNavigableSet +8 -1: asSetter +3 -1: dom +41 -1: (I)[Ljava/util/WeakHashMap$Entry; +16 -1: localeExtensions +21 -1: sun/net/www/ParseUtil +21 -1: Ljava/nio/ByteBuffer; +29 -1: java/util/concurrent/TimeUnit +25 -1: java/lang/CharacterData00 +15 -1: sun/misc/Unsafe +28 -1: java/io/ByteArrayInputStream +3 -1: dow +25 -1: java/lang/CharacterData01 +25 -1: java/lang/CharacterData02 +6 -1: STORED +11 -1: isTransient +8 -1: function +16 -1: getCanonicalFile +13 -1: ,useDaylight= +24 -1: domain (context is null) +12 -1: Cleaner.java +17 -1: CalendarDate.java +49 -1: Lsun/reflect/generics/repository/FieldRepository; +14 -1: forInputString +25 -1: java/lang/CharacterData0E +67 -1: (Ljava/lang/Object;Ljava/util/function/Supplier;)Ljava/lang/Object; +19 -1: codePointBeforeImpl +6 -1: script +21 -1: systemNativeLibraries +38 -1: ([Ljava/lang/Class;)Ljava/lang/String; +14 -1: CONTENT_LENGTH +19 -1: HeapCharBuffer.java +22 -1: ExtendedProviderHolder +41 -1: java/lang/invoke/InvokerBytecodeGenerator +12 -1: basicInvoker +26 -1: ([Ljava/lang/Comparable;)V +10 -1: val$tclass +47 -1: (Ljava/lang/Throwable;)Lsun/invoke/empty/Empty; +18 -1: isLegalReplacement +22 -1: spliteratorUnknownSize +15 -1: SynchronizedSet +16 -1: MethodParameters +22 -1: desiredAssertionStatus +29 -1: ()Ljava/util/ArrayDeque; +36 -1: ()Ljava/lang/reflect/Constructor<*>; +66 -1: ()Ljava/util/Map; +58 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;)V +50 -1: (Ljava/util/concurrent/CountedCompleter;[J[JIIII)V +14 -1: requireNonNull +21 -1: java/lang/ThreadGroup +95 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;ILjava/util/concurrent/ConcurrentHashMap$Node;)V +76 -1: (Ljava/nio/channels/WritableByteChannel;Ljava/nio/charset/CharsetEncoder;I)V +14 -1: reflectionData +33 -1: Ljava/lang/invoke/MethodTypeForm; +7 -1: tuesday +31 -1: ()Lsun/misc/JavaSecurityAccess; +14 -1: fieldFilterMap +28 -1: ([Ljava/lang/ThreadGroup;Z)I +7 -1: ibm-850 +83 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/lang/management/GarbageCollectorMXBean; +7 -1: ibm-852 +5 -1: cesu8 +14 -1: ForwardingNode +29 -1: (Ljava/nio/ByteBuffer;IIIII)V +7 -1: ibm-855 +12 -1: SingletonSet +16 -1: isOtherUppercase +15 -1: FIELD_UNDEFINED +9 -1: makeEntry +7 -1: ibm-857 +10 -1: extensions +10 -1: longStream +19 -1: getGenericSignature +7 -1: newNode +8 -1: jarNames +25 -1: java/util/jar/JarVerifier +49 -1: ()[Lsun/reflect/generics/tree/ClassTypeSignature; +4 -1: wait +115 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/repository/ClassRepository; +56 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/Object; +65 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;)V +7 -1: ibm-862 +9 -1: ISO646-US +7 -1: ibm-866 +16 -1: extendedProvider +7 -1: ([C[C)Z +93 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodHandle; +8 -1: getHours +21 -1: ()[Ljava/lang/String; +187 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$ReduceKeysTask;Ljava/util/function/BiFunction;)V +106 -1: Ljava/util/concurrent/locks/ReentrantLock;Ljava/io/Serializable; +24 -1: java/nio/file/FileSystem +14 -1: ForEachKeyTask +13 -1: defaultLocale +20 -1: constructorModifiers +13 -1: asWrapperType +42 -1: (Ljava/lang/String;ZI)Ljava/lang/Class<*>; +17 -1: BaseCalendar.java +76 -1: (Ljava/util/jar/JarFile;Ljava/util/jar/JarEntry;)[Ljava/security/CodeSigner; +14 -1: isSynchronized +27 -1: java/nio/DirectByteBuffer$1 +3 -1: ()B +7 -1: ibm-874 +12 -1: exactInvoker +3 -1: ()C +39 -1: (Ljava/lang/Thread;Ljava/lang/Object;)V +3 -1: ()D +3 -1: ()F +27 -1: [Ljava/lang/reflect/Method; +10 -1: floatValue +3 -1: ()I +3 -1: ()J +18 -1: getLocaleResources +59 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesTask +67 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/Hashtable$Entry;)V +11 -1: maxPriority +11 -1: getStringAt +60 -1: (Ljava/lang/ClassValue$Version;)Ljava/lang/ClassValue$Entry; +3 -1: ()S +49 -1: (Ljava/lang/String;)Ljava/io/ExpiringCache$Entry; +42 -1: (III)Lsun/util/calendar/BaseCalendar$Date; +82 -1: (Ljava/util/Set;Ljava/lang/Object;)Ljava/util/Set; +62 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)Ljava/util/Map; +3 -1: ()V +24 -1: ()Ljava/nio/ShortBuffer; +29 -1: file descriptor can't be null +3 -1: ()Z +7 -1: matcher +66 -1: (Ljava/lang/reflect/Constructor;)Lsun/reflect/ConstructorAccessor; +7 -1: matches +12 -1: getAuthority +16 -1: java/lang/Object +5 -1: (IC)V +17 -1: EmptyListIterator +8 -1: charsets +8 -1: sameFile +47 -1: (TT;Ljava/util/function/UnaryOperator;)TV; +16 -1: overwrittenEntry +15 -1: reinvokerTarget +11 -1: isUpperCase +5 -1: toUri +9 -1: GMT+00:00 +33 -1: java/util/concurrent/ForkJoinPool +10 -1: parseFloat +53 -1: java/util/concurrent/ConcurrentHashMap$SearchKeysTask +48 -1: (Ljava/lang/Object;Ljava/util/LinkedList$Node;)V +82 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;Ljava/lang/Object;ILjava/lang/Class<*>;)V +15 -1: reduceCacheLoad +76 -1: (Ljava/lang/Class<*>;[Ljava/lang/reflect/Method;)[Ljava/lang/reflect/Method; +20 -1: singletonSpliterator +24 -1: getTransitionEpochSecond +24 -1: MapReduceValuesToIntTask +13 -1: ALLOWED_FLAGS +55 -1: (Ljava/lang/reflect/Field;Z)Lsun/reflect/FieldAccessor; +34 -1: [Ljava/lang/annotation/Annotation; +10 -1: readBuffer +21 -1: Illegal month value: +31 -1: java/security/SecureClassLoader +12 -1: reinitialize +5 -1: limit +4 -1: grow +15 -1: getCreationTime +7 -1: , from +25 -1: (Ljava/lang/ClassValue;)V +13 -1: java.compiler +37 -1: ()Ljava/util/Set; +6 -1: FJChar +16 -1: getFieldAccessor +4 -1: eras +11 -1: isSupported +24 -1: ()Ljava/text/DateFormat; +32 -1: java/util/Collections$CopiesList +32 -1: java/io/NotSerializableException +15 -1: typeAnnotations +27 -1: defaultAllowUserInteraction +57 -1: (Ljava/lang/String;I[Ljava/lang/invoke/LambdaForm$Name;)V +18 -1: checkArgumentTypes +71 -1: (Lsun/util/calendar/BaseCalendar$Date;)Lsun/util/calendar/BaseCalendar; +10 -1: isMirrored +27 -1: (I)Ljava/lang/Thread$State; +26 -1: (Ljava/util/Collection;Z)Z +6 -1: ibm367 +16 -1: isAssignableFrom +7 -1: readUTF +35 -1: Ljava/lang/ref/ReferenceQueue; +56 -1: ([Ljava/util/HashMap$Node;Ljava/util/HashMap$TreeNode;)V +8 -1: MANDATED +18 -1: canonicalizeRegion +11 -1: checkAccept +44 -1: (Ljava/net/Proxy;)Lsun/net/ApplicationProxy; +8 -1: ECMA-118 +22 -1: ReflectPermission.java +4 -1: _put +41 -1: java.lang.invoke.MethodHandle.DEBUG_NAMES +47 -1: java/util/concurrent/ConcurrentHashMap$TreeNode +44 -1: (Ljava/net/URL;[Ljava/security/CodeSigner;)V +5 -1: april +44 -1: ([Ljava/lang/Class<*>;Ljava/lang/Class<*>;)V +150 -1: Ljava/util/concurrent/ConcurrentHashMap$CollectionView;Ljava/util/Set;Ljava/io/Serializable; +91 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/HashMap$Node;)Ljava/util/HashMap$TreeNode; +26 -1: sun/net/util/IPAddressUtil +8 -1: Modifier +9 -1: isVarargs +24 -1: -- listing properties -- +16 -1: hasAllPermission +27 -1: MapReduceMappingsToLongTask +29 -1: sharedGetParameterAnnotations +9 -1: argCounts +11 -1: toLocalTime +89 -1: (Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName; +4 -1: ROOT +20 -1: sun.reflect.noCaches +18 -1: UnicodeBigUnmarked +4 -1: Lazy +35 -1: java/lang/invoke/SimpleMethodHandle +20 -1: (I)Ljava/nio/Buffer; +48 -1: ()Lsun/reflect/generics/tree/ClassTypeSignature; +31 -1: (I[CII)Ljava/lang/StringBuffer; +17 -1: America/Anchorage +7 -1: markpos +9 -1: enumerate +11 -1: parseLocale +24 -1: java.launcher.cls.error1 +46 -1: (ILjava/lang/Object;)Ljava/lang/StringBuilder; +24 -1: java.launcher.cls.error2 +24 -1: java.launcher.cls.error3 +24 -1: java.launcher.cls.error4 +21 -1: java/util/ArrayList$1 +17 -1: getExceptionTypes +24 -1: java.launcher.cls.error5 +30 -1: java/util/Spliterator$OfDouble +10 -1: forDecoder +8 -1: getEntry +10 -1: checkGuard +12 -1: checkInitted +34 -1: Lsun/util/locale/LocaleExtensions; +41 -1: java/util/ArraysParallelSortHelpers$FJInt +10 -1: findStatic +22 -1: setConstructorAccessor +34 -1: Lsun/misc/URLClassPath$FileLoader; +20 -1: not a reinvoker MH: +16 -1: LongCumulateTask +11 -1: checkAccess +14 -1: SearchKeysTask +36 -1: ()[Ljava/lang/reflect/AnnotatedType; +11 -1: initDefault diff --git a/test/hotspot/jtreg/runtime/appcds/FieldAnnotationsTest.java b/test/hotspot/jtreg/runtime/appcds/FieldAnnotationsTest.java new file mode 100644 index 00000000000..88a346ff850 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/FieldAnnotationsTest.java @@ -0,0 +1,67 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Test for field annotations. + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/FieldAnnotationsApp.java test-classes/MyAnnotation.java + * @run main FieldAnnotationsTest + */ + +import jdk.test.lib.process.OutputAnalyzer; + +// This is a test for the handling of multi-dimensional Arrays in MetaspaceClosure. +// +// We choose FieldAnnotations because they happen to be implemented as a multi-dimension +// Array (Annotations::_fields_annotations, which is of type Array*>*, +// and is handled by the template class PointerArrayRef in metaspaceClosure.hpp). +// +// Specifically, we are testing the following C code, where _fields_annotations is non-NULL: +// +// void Annotations::metaspace_pointers_do(MetaspaceClosure* it) { +// ... +// it->push(&_fields_annotations); +// +// which will be matched with the function +// +// template void MetaspaceClosure::push(Array** mpp, Writability w = _default) +// +public class FieldAnnotationsTest { + public static void main(String[] args) throws Exception { + String[] ARCHIVE_CLASSES = {"FieldAnnotationsApp", "MyAnnotation"}; + String appJar = JarBuilder.build("FieldAnnotationsTest", ARCHIVE_CLASSES); + + OutputAnalyzer dumpOutput = TestCommon.dump( + appJar, ARCHIVE_CLASSES); + TestCommon.checkDump(dumpOutput); + + OutputAnalyzer execOutput = TestCommon.exec(appJar, "FieldAnnotationsApp"); + TestCommon.checkExec(execOutput, "Field annotations are OK."); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/FreeUnusedMetadata.java b/test/hotspot/jtreg/runtime/appcds/FreeUnusedMetadata.java new file mode 100644 index 00000000000..30f167cdf20 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/FreeUnusedMetadata.java @@ -0,0 +1,118 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Unused metadata created during dump time should be freed from the CDS archive. + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules jdk.jartool/sun.tools.jar + * @compile test-classes/MethodNoReturn.jasm test-classes/Hello.java + * @run main FreeUnusedMetadata + */ + +import java.nio.file.Files; +import java.nio.file.Paths; +import jdk.test.lib.process.OutputAnalyzer; + +public class FreeUnusedMetadata { + static byte iconst_1 = 4; + static byte pop = 87; + static byte[] pattern = { // This has the same sequence as in test-classes/MethodNoReturn.jasm + iconst_1, + pop, + iconst_1, + pop, + iconst_1, + pop, + iconst_1, + pop, + iconst_1, + pop, + iconst_1, + pop, + iconst_1, + pop, + iconst_1, + pop, + iconst_1, + pop, + iconst_1, + pop, + iconst_1, + iconst_1, + iconst_1, + iconst_1, + iconst_1, + iconst_1, + iconst_1, + iconst_1, + pop, + pop, + pop, + pop, + pop, + pop, + pop, + pop + }; + + public static void main(String[] args) throws Exception { + String[] ARCHIVE_CLASSES = {"Hello", "MethodNoReturn"}; + String appJar = JarBuilder.build("FreeUnusedMetadata", ARCHIVE_CLASSES); + + OutputAnalyzer dumpOutput = TestCommon.dump( + appJar, ARCHIVE_CLASSES); + TestCommon.checkDump(dumpOutput, "Loading classes to share"); + + OutputAnalyzer execOutput = TestCommon.exec(appJar, "Hello"); + TestCommon.checkExec(execOutput, "Hello World"); + + + String archive = TestCommon.getCurrentArchiveName(); + System.out.println("Checking for pattern inside " + archive + "..."); + + byte[] data = Files.readAllBytes(Paths.get(archive)); + int max = data.length - pattern.length; + for (int i=0; i \ + // -C .\ + // --release 9 -C . + // the last line begins with "--release" corresponds to the optional versionArgs. + public static void build(String jarName, File dir, String man, String ...versionArgs) + throws Exception { + ArrayList args = new ArrayList(); + if (man != null) { + args.add("cfm"); + } else { + args.add("cf"); + } + args.add(classDir + File.separator + jarName + ".jar"); + if (man != null) { + args.add(man); + } + args.add("-C"); + args.add(dir.getAbsolutePath()); + args.add("."); + for (String verArg : versionArgs) { + args.add(verArg); + } + createJar(args); + } + + public static String build(String jarName, String ...classNames) + throws Exception { + + return createSimpleJar(classDir, getJarFilePath(jarName), classNames); + } + + public static String build(boolean classesInWorkDir, String jarName, String ...classNames) + throws Exception { + if (classesInWorkDir) { + return createSimpleJar(".", getJarFilePath(jarName), classNames); + } else { + return build(jarName, classNames); + } + } + + + public static String buildWithManifest(String jarName, String manifest, + String jarClassesDir, String ...classNames) throws Exception { + String jarPath = getJarFilePath(jarName); + ArrayList args = new ArrayList(); + args.add("cvfm"); + args.add(jarPath); + args.add(System.getProperty("test.src") + File.separator + "test-classes" + + File.separator + manifest); + addClassArgs(args, jarClassesDir, classNames); + createJar(args); + + return jarPath; + } + + + // Execute: jar uvf $jarFile -C $dir . + static void update(String jarFile, String dir) throws Exception { + String jarExe = JDKToolFinder.getJDKTool("jar"); + + ArrayList args = new ArrayList<>(); + args.add(jarExe); + args.add("uvf"); + args.add(jarFile); + args.add("-C"); + args.add(dir); + args.add("."); + + executeProcess(args.toArray(new String[1])); + } + + + private static String createSimpleJar(String jarclassDir, String jarName, + String[] classNames) throws Exception { + + ArrayList args = new ArrayList(); + args.add("cf"); + args.add(jarName); + addClassArgs(args, jarclassDir, classNames); + createJar(args); + + return jarName; + } + + private static void addClassArgs(ArrayList args, String jarclassDir, + String[] classNames) { + + for (String name : classNames) { + args.add("-C"); + args.add(jarclassDir); + args.add(name + ".class"); + } + } + + private static void createJar(ArrayList args) { + if (DEBUG) printIterable("createJar args: ", args); + + Main jarTool = new Main(System.out, System.err, "jar"); + if (!jarTool.run(args.toArray(new String[1]))) { + throw new RuntimeException("jar operation failed"); + } + } + + // Many AppCDS tests use the same simple "Hello.jar" which contains + // simple Hello.class and does not specify additional attributes. + // For this common use case, use this method to get the jar path. + // The method will check if the jar already exists + // (created by another test or test run), and will create the jar + // if it does not exist + public static String getOrCreateHelloJar() throws Exception { + String jarPath = getJarFilePath("hello"); + + File jarFile = new File(jarPath); + if (jarFile.exists()) { + return jarPath; + } else { + return build("hello", "Hello"); + } + } + + public static void compile(String dstPath, String source, String... extraArgs) throws Exception { + ArrayList args = new ArrayList(); + args.add(JDKToolFinder.getCompileJDKTool("javac")); + args.add("-d"); + args.add(dstPath); + if (extraArgs != null) { + for (String s : extraArgs) { + args.add(s); + } + } + args.add(source); + + if (DEBUG) printIterable("compile args: ", args); + + ProcessBuilder pb = new ProcessBuilder(args); + OutputAnalyzer output = new OutputAnalyzer(pb.start()); + output.shouldHaveExitValue(0); + } + + public static void signJar() throws Exception { + String keyTool = JDKToolFinder.getJDKTool("keytool"); + String jarSigner = JDKToolFinder.getJDKTool("jarsigner"); + String classDir = System.getProperty("test.classes"); + String FS = File.separator; + + executeProcess(keyTool, + "-genkey", "-keystore", "./keystore", "-alias", "mykey", + "-storepass", "abc123", "-keypass", "abc123", + "-dname", "CN=jvmtest") + .shouldHaveExitValue(0); + + executeProcess(jarSigner, + "-keystore", "./keystore", "-storepass", "abc123", "-keypass", + "abc123", "-signedjar", classDir + FS + "signed_hello.jar", + classDir + FS + "hello.jar", "mykey") + .shouldHaveExitValue(0); + } + + private static OutputAnalyzer executeProcess(String... cmds) + throws Exception { + + JarBuilder.printArray("executeProcess: ", cmds); + return ProcessTools.executeProcess(new ProcessBuilder(cmds)); + } + + // diagnostic + public static void printIterable(String msg, Iterable l) { + StringBuilder sum = new StringBuilder(); + for (String s : l) { + sum.append(s).append(' '); + } + System.out.println(msg + sum.toString()); + } + + public static void printArray(String msg, String[] l) { + StringBuilder sum = new StringBuilder(); + for (String s : l) { + sum.append(s).append(' '); + } + System.out.println(msg + sum.toString()); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/JvmtiAddPath.java b/test/hotspot/jtreg/runtime/appcds/JvmtiAddPath.java new file mode 100644 index 00000000000..12d41a2c066 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/JvmtiAddPath.java @@ -0,0 +1,107 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary JvmtiEnv::AddToBootstrapClassLoaderSearch and JvmtiEnv::AddToSystemClassLoaderSearch should disable AppCDS + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @bug 8060592 + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @build sun.hotspot.WhiteBox + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @compile test-classes/Hello.java + * @compile test-classes/JvmtiApp.java + * @run main JvmtiAddPath + */ + +import java.io.File; +import jdk.test.lib.process.OutputAnalyzer; +import sun.hotspot.WhiteBox; + +public class JvmtiAddPath { + static String use_whitebox_jar; + static String[] no_extra_matches = {}; + static String[] check_appcds_enabled = { + "[class,load] ExtraClass source: shared object" + }; + static String[] check_appcds_disabled = { + "[class,load] ExtraClass source: file:" + }; + + static void run(String cp, String... args) throws Exception { + run(no_extra_matches, cp, args); + } + + static void run(String[] extra_matches, String cp, String... args) throws Exception { + String[] opts = {"-cp", cp, "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI", use_whitebox_jar}; + opts = TestCommon.concat(opts, args); + OutputAnalyzer output = TestCommon.execCommon(opts); + TestCommon.checkExec(output, extra_matches); + } + + public static void main(String[] args) throws Exception { + JarBuilder.build("jvmti_addboot", "Hello"); + JarBuilder.build("jvmti_addapp", "Hello"); + JarBuilder.build("jvmti_app", "JvmtiApp", "ExtraClass"); + JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox"); + + // In all the test cases below, appJar does not contain Hello.class. Instead, we + // append JAR file(s) that contain Hello.class to the boot classpath, the app + // classpath, or both, and verify that Hello.class is loaded by the expected ClassLoader. + String appJar = TestCommon.getTestJar("jvmti_app.jar"); // contains JvmtiApp.class + String addappJar = TestCommon.getTestJar("jvmti_addapp.jar"); // contains Hello.class + String addbootJar = TestCommon.getTestJar("jvmti_addboot.jar"); // contains Hello.class + String twoAppJars = appJar + File.pathSeparator + addappJar; + String wbJar = TestCommon.getTestJar("WhiteBox.jar"); + use_whitebox_jar = "-Xbootclasspath/a:" + wbJar; + + TestCommon.testDump(appJar, TestCommon.list("JvmtiApp", "ExtraClass"), use_whitebox_jar); + + System.out.println("Test case 1: not adding any paths - Hello.class should not be found"); + run(check_appcds_enabled, appJar, "-Xlog:class+load", "JvmtiApp", "noadd"); // appcds should be enabled + + System.out.println("Test case 2: add to boot classpath only - should find Hello.class in boot loader"); + run(check_appcds_disabled, appJar, "-Xlog:class+load", "JvmtiApp", "bootonly", addbootJar); // appcds should be disabled + + System.out.println("Test case 3: add to app classpath only - should find Hello.class in app loader"); + run(appJar, "JvmtiApp", "apponly", addappJar); + + System.out.println("Test case 4: add to boot and app paths - should find Hello.class in boot loader"); + run(appJar, "JvmtiApp", "appandboot", addbootJar, addappJar); + + System.out.println("Test case 5: add to app using -cp, but add to boot using JVMTI - should find Hello.class in boot loader"); + run(twoAppJars, "JvmtiApp", "bootonly", addappJar); + + System.out.println("Test case 6: add to app using AppCDS, but add to boot using JVMTI - should find Hello.class in boot loader"); + TestCommon.testDump(twoAppJars, TestCommon.list("JvmtiApp", "ExtraClass", "Hello"), use_whitebox_jar); + run(twoAppJars, "JvmtiApp", "bootonly", addappJar); + + System.out.println("Test case 7: add to app using AppCDS, no JVMTI calls - should find Hello.class in app loader"); + run(twoAppJars, "JvmtiApp", "noadd-appcds"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/MismatchedUseAppCDS.java b/test/hotspot/jtreg/runtime/appcds/MismatchedUseAppCDS.java new file mode 100644 index 00000000000..085e79e622d --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/MismatchedUseAppCDS.java @@ -0,0 +1,81 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Try different combination of mismatched UseAppCDS between dump time and run time. + * (Note: AppCDS does not support uncompressed oops.) + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/CheckIfShared.java + * @build sun.hotspot.WhiteBox + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @run main MismatchedUseAppCDS + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class MismatchedUseAppCDS { + public static void main(String[] args) throws Exception { + String wbJar = JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox"); + String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar; + + String appJar = JarBuilder.build("MismatchedUseAppCDS", "CheckIfShared"); + + OutputAnalyzer output; + + // (1): dump with -XX:+UseAppCDS, but run with -XX:-UseAppCDS + TestCommon.testDump(appJar, TestCommon.list("CheckIfShared"), + // command-line arguments ... + "-XX:+UseAppCDS", + use_whitebox_jar); + + output = TestCommon.exec(appJar, + // command-line arguments ... + use_whitebox_jar, + "-XX:-UseAppCDS", + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", + "CheckIfShared", "false"); + TestCommon.checkExec(output); + + // (2): dump with -XX:-UseAppCDS, but run with -XX:+UseAppCDS + TestCommon.testDump(appJar, TestCommon.list("CheckIfShared"), + // command-line arguments ... + "-XX:-UseAppCDS", + use_whitebox_jar); + + output = TestCommon.exec(appJar, + // command-line arguments ... + use_whitebox_jar, + "-XX:+UseAppCDS", + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", + "CheckIfShared", "false"); + TestCommon.checkExec(output); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/MissingSuperTest.java b/test/hotspot/jtreg/runtime/appcds/MissingSuperTest.java new file mode 100644 index 00000000000..fa9bfb93493 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/MissingSuperTest.java @@ -0,0 +1,52 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary When super class is missing during dumping, no crash should happen. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/MissingSuper.java + * @run main MissingSuperTest + */ + +public class MissingSuperTest { + + public static void main(String[] args) throws Exception { + // The classes "MissingSuperSup" and "MissingSuperIntf" are intentionally not + // included into the jar to provoke the test condition + JarBuilder.build("missing_super", "MissingSuper", + "MissingSuperSub", "MissingSuperImpl"); + + String appJar = TestCommon.getTestJar("missing_super.jar"); + TestCommon.test(appJar, TestCommon.list("MissingSuper", + "MissingSuperSub", + "MissingSuperImpl"), + "MissingSuper"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/MultiProcessSharing.java b/test/hotspot/jtreg/runtime/appcds/MultiProcessSharing.java new file mode 100644 index 00000000000..25861868344 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/MultiProcessSharing.java @@ -0,0 +1,144 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Run multiple processes with the same archive, ensure they share + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @build sun.hotspot.WhiteBox + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @compile test-classes/MultiProcClass.java + * @run main MultiProcessSharing + */ + +import java.io.File; +import jdk.test.lib.Asserts; +import jdk.test.lib.Platform; +import jdk.test.lib.process.OutputAnalyzer; +import sun.hotspot.WhiteBox; + + +public class MultiProcessSharing { + static String useWbJar; + static String sharedClass1Jar; + static boolean checkPmap = false; + + public static void main(String[] args) throws Exception { + String wbJar = JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox"); + useWbJar = "-Xbootclasspath/a:" + wbJar; + sharedClass1Jar = JarBuilder.build("shared_class1", "MultiProcClass"); + + // create an archive + OutputAnalyzer out = TestCommon.dump(sharedClass1Jar, + TestCommon.list("MultiProcClass"), useWbJar); + TestCommon.checkDump(out); + + // determine whether OK to use pmap for extra test verification + long myPid = ProcessHandle.current().pid(); + checkPmap = (Platform.isLinux() && (MultiProcClass.runPmap(myPid, false) == 0)); + System.out.println("MultiProcessSharing: checkPmap is " + checkPmap); + + // use an archive in several processes concurrently + int numProcesses = 3; + Thread[] threads = new Thread[numProcesses]; + ProcessHandler[] processHandlers = new ProcessHandler[numProcesses]; + for (int i = 0; i < numProcesses; i++) { + processHandlers[i] = new ProcessHandler(i); + threads[i] = new Thread(processHandlers[i]); + } + + for (Thread t : threads) { + t.start(); + } + + for (Thread t : threads) { + try { + t.join(); + } catch (InterruptedException ie) { + throw ie; + } + } + + // check results + for (ProcessHandler ph : processHandlers) { + TestCommon.checkExec(ph.out); + if (checkPmap && !TestCommon.isUnableToMap(ph.out)) { + checkPmapOutput(ph.out.getOutput()); + } + } + } + + + static class ProcessHandler implements Runnable { + int processNumber; + OutputAnalyzer out; + + ProcessHandler(int processNumber) { + this.processNumber = processNumber; + } + + @Override + public void run() { + try { + out = TestCommon.exec(sharedClass1Jar, + "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI", useWbJar, + "MultiProcClass", "" + processNumber, "" + checkPmap); + } catch (Exception e) { + throw new RuntimeException("Error occurred when using archive, exec()" + e); + } + } + } + + + private static void checkPmapOutput(String stdio) { + System.out.println("Checking pmap output ..."); + String[] lines = stdio.split("\n"); + + boolean foundJsa = false; + boolean foundReadOnlyJsaSection = false; + + for (String line : lines) { + if (line.contains(TestCommon.getCurrentArchiveName())) + System.out.println(line); + foundJsa = true; + if (line.contains("r--")) { + foundReadOnlyJsaSection = true; + } + + // On certain ARM platforms system maps r/o memory mapped files + // as r/x; see JDK-8145694 for details + if ( (Platform.isARM() || Platform.isAArch64()) && line.contains("r-x") ) { + foundReadOnlyJsaSection = true; + } + } + + Asserts.assertTrue(foundJsa && foundReadOnlyJsaSection); + } + +} diff --git a/test/hotspot/jtreg/runtime/appcds/MultiReleaseJars.java b/test/hotspot/jtreg/runtime/appcds/MultiReleaseJars.java new file mode 100644 index 00000000000..fdc6ef06492 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/MultiReleaseJars.java @@ -0,0 +1,238 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test MultiReleaseJars + * @bug 8170105 + * @summary Test multi-release jar with AppCDS. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * @run main/othervm MultiReleaseJars + */ + +import java.io.File; +import java.io.FileOutputStream; +import java.io.PrintStream; +import java.io.IOException; +import jdk.test.lib.process.OutputAnalyzer; + +public class MultiReleaseJars { + + static final int MAJOR_VERSION = Runtime.version().major(); + static final String MAJOR_VERSION_STRING = String.valueOf(Runtime.version().major()); + + static String[] getMain() { + String[] sts = { + "package version;", + "public class Main {", + " public static void main(String[] args) {", + " Version version = new Version();", + " System.out.println(\"I am running on version \" + version.getVersion());", + " }", + "}" + }; + return sts; + } + + static String[] getVersion(int version) { + String[] sts = { + "package version;", + "public class Version {", + " public int getVersion(){ return " + version + "; }", + "}" + }; + return sts; + } + + static void writeFile(File file, String... contents) throws Exception { + if (contents == null) { + throw new java.lang.RuntimeException("No input for writing to file" + file); + } + FileOutputStream fos = new FileOutputStream(file); + PrintStream ps = new PrintStream(fos); + for (String str : contents) { + ps.println(str); + } + ps.close(); + fos.close(); + } + + /* version.jar entries and files: + * META-INF/ + * META-INF/MANIFEST.MF + * version/ + * version/Main.class + * version/Version.class + * META-INF/versions/ + * META-INF/versions// + * META-INF/versions//version/ + * META-INF/versions//version/Version.class + */ + static void createClassFilesAndJar() throws Exception { + String tempDir = System.getProperty("test.classes"); + File baseDir = new File(tempDir + File.separator + "base"); + File vDir = new File(tempDir + File.separator + MAJOR_VERSION_STRING); + + baseDir.mkdirs(); + vDir.mkdirs(); + + File fileMain = TestCommon.getOutputSourceFile("Main.java"); + writeFile(fileMain, getMain()); + + File fileVersion = TestCommon.getOutputSourceFile("Version.java"); + writeFile(fileVersion, getVersion(7)); + JarBuilder.compile(baseDir.getAbsolutePath(), fileVersion.getAbsolutePath(), "--release", "7"); + JarBuilder.compile(baseDir.getAbsolutePath(), fileMain.getAbsolutePath(), + "-cp", baseDir.getAbsolutePath(), "--release", MAJOR_VERSION_STRING); + + String[] meta = { + "Multi-Release: true", + "Main-Class: version.Main" + }; + File metainf = new File(tempDir, "mf.txt"); + writeFile(metainf, meta); + + fileVersion = TestCommon.getOutputSourceFile("Version.java"); + writeFile(fileVersion, getVersion(MAJOR_VERSION)); + JarBuilder.compile(vDir.getAbsolutePath(), fileVersion.getAbsolutePath(), "--release", MAJOR_VERSION_STRING); + + JarBuilder.build("version", baseDir, metainf.getAbsolutePath(), + "--release", MAJOR_VERSION_STRING, "-C", vDir.getAbsolutePath(), "."); + + // the following jar file is for testing case-insensitive "Multi-Release" + // attibute name + String[] meta2 = { + "multi-Release: true", + "Main-Class: version.Main" + }; + metainf = new File(tempDir, "mf2.txt"); + writeFile(metainf, meta2); + JarBuilder.build("version2", baseDir, metainf.getAbsolutePath(), + "--release", MAJOR_VERSION_STRING, "-C", vDir.getAbsolutePath(), "."); + } + + static void checkExecOutput(OutputAnalyzer output, String expectedOutput) throws Exception { + try { + TestCommon.checkExec(output, expectedOutput); + } catch (java.lang.RuntimeException re) { + String cause = re.getMessage(); + if (!expectedOutput.equals(cause)) { + throw re; + } + } + } + + public static void main(String... args) throws Exception { + // create version.jar which contains Main.class and Version.class. + // Version.class has two versions: 8 and the current version. + createClassFilesAndJar(); + + String mainClass = "version.Main"; + String loadInfo = "[class,load] version.Version source: shared objects file"; + String appClasses[] = {"version/Main", "version/Version"}; + String appJar = TestCommon.getTestJar("version.jar"); + String appJar2 = TestCommon.getTestJar("version2.jar"); + String verboseMode = "-verbose:class"; + String enableMultiRelease = "-Djdk.util.jar.enableMultiRelease=true"; + String jarVersion = null; + String expectedOutput = null; + + // 1. default to highest version + // if META-INF/versions exists, no other commandline options like -Djdk.util.jar.version and + // -Djdk.util.jar.enableMultiRelease passed to vm + OutputAnalyzer output = TestCommon.dump(appJar, appClasses); + output.shouldContain("Loading classes to share: done."); + output.shouldHaveExitValue(0); + + output = TestCommon.exec(appJar, verboseMode, mainClass); + checkExecOutput(output, "I am running on version " + MAJOR_VERSION_STRING); + + // 2. Test versions 7 and the current major version. + // -Djdk.util.jar.enableMultiRelease=true (or force), default is true. + // a) -Djdk.util.jar.version=7 does not exist in jar. + // It will fallback to the root version which is also 7 in this test. + // b) -Djdk.util.jar.version=MAJOR_VERSION exists in the jar. + for (int i : new int[] {7, MAJOR_VERSION}) { + jarVersion = "-Djdk.util.jar.version=" + i; + expectedOutput = "I am running on version " + i; + output = TestCommon.dump(appJar, appClasses, enableMultiRelease, jarVersion); + output.shouldContain("Loading classes to share: done."); + output.shouldHaveExitValue(0); + + output = TestCommon.exec(appJar, verboseMode, mainClass); + checkExecOutput(output, expectedOutput); + } + + // 3. For unsupported version, 5 and current major version + 1, the multiversion + // will be turned off, so it will use the default (root) version. + for (int i : new int[] {5, MAJOR_VERSION + 1}) { + jarVersion = "-Djdk.util.jar.version=" + i; + output = TestCommon.dump(appJar, appClasses, enableMultiRelease, jarVersion); + output.shouldHaveExitValue(0); + // With the fix for 8172218, multi-release jar is being handled in + // jdk corelib which doesn't emit the following warning message. + //output.shouldContain("JDK" + i + " is not supported in multiple version jars"); + + output = TestCommon.exec(appJar, verboseMode, mainClass); + if (i == 5) + checkExecOutput(output, "I am running on version 7"); + else + checkExecOutput(output, "I am running on version " + MAJOR_VERSION_STRING); + } + + // 4. If explicitly disabled from command line for multiversion jar, it will use default + // version at root regardless multiversion versions exists. + // -Djdk.util.jar.enableMultiRelease=false (not 'true' or 'force') + for (int i = 6; i < MAJOR_VERSION + 1; i++) { + jarVersion = "-Djdk.util.jar.version=" + i; + output = TestCommon.dump(appJar, appClasses, "-Djdk.util.jar.enableMultiRelease=false", jarVersion); + output.shouldHaveExitValue(0); + + output = TestCommon.exec(appJar, verboseMode, mainClass); + expectedOutput = "I am running on version 7"; + checkExecOutput(output, expectedOutput); + } + + // 5. Sanity test with -Xbootclasspath/a + // AppCDS behaves the same as the non-AppCDS case. A multi-release + // jar file in the -Xbootclasspath/a will be ignored. + output = TestCommon.dump(appJar, appClasses, "-Xbootclasspath/a:" + appJar, enableMultiRelease, jarVersion); + output.shouldContain("Loading classes to share: done."); + output.shouldHaveExitValue(0); + + output = TestCommon.exec(appJar, "-Xbootclasspath/a:" + appJar, verboseMode, mainClass); + checkExecOutput(output, "I am running on version 7"); + + // 6. Sanity test case-insensitive "Multi-Release" attribute name + output = TestCommon.dump(appJar2, appClasses); + output.shouldContain("Loading classes to share: done."); + output.shouldHaveExitValue(0); + + output = TestCommon.exec(appJar2, verboseMode, mainClass); + checkExecOutput(output, "I am running on version " + MAJOR_VERSION_STRING); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/OldClassTest.java b/test/hotspot/jtreg/runtime/appcds/OldClassTest.java new file mode 100644 index 00000000000..d41faf33608 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/OldClassTest.java @@ -0,0 +1,167 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary classes with major version < JDK_1.5 (48) should not be included in CDS + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.org.objectweb.asm + * java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java + * @run build TestCommon JarBuilder + * @run main OldClassTest + */ + +import java.io.File; +import java.io.FileOutputStream; +import jdk.test.lib.process.OutputAnalyzer; +import java.nio.file.Files; + +import java.util.*; +import jdk.internal.org.objectweb.asm.*; + +public class OldClassTest implements Opcodes { + + public static void main(String[] args) throws Exception { + File jarSrcFile = new File(JarBuilder.getOrCreateHelloJar()); + + File dir = new File(System.getProperty("test.classes", ".")); + File jarFile = new File(dir, "OldClassTest_old.jar"); + String jar = jarFile.getPath(); + + if (!jarFile.exists() || jarFile.lastModified() < jarSrcFile.lastModified()) { + createTestJarFile(jarSrcFile, jarFile); + } else { + System.out.println("Already up-to-date: " + jarFile); + } + + String appClasses[] = TestCommon.list("Hello"); + + // CASE 1: pre-JDK 1.5 compiled classes should be excluded from the dump + OutputAnalyzer output = TestCommon.dump(jar, appClasses); + TestCommon.checkExecReturn(output, 0, true, "Pre JDK 1.5 class not supported by CDS"); + + output = TestCommon.execCommon( + "-cp", jar, + "-verbose:class", + "Hello"); + TestCommon.checkExecReturn(output, 0, true, "Hello Unicode world (Old)"); + + // CASE 2: if we exlcude old version of this class, we should not pick up + // the newer version of this class in a subsequent classpath element. + String classpath = jar + File.pathSeparator + jarSrcFile.getPath(); + output = TestCommon.dump(classpath, appClasses); + TestCommon.checkExecReturn(output, 0, true, "Pre JDK 1.5 class not supported by CDS"); + + output = TestCommon.execCommon( + "-cp", classpath, + "-verbose:class", + "Hello"); + TestCommon.checkExecReturn(output, 0, true, "Hello Unicode world (Old)"); + } + + static void createTestJarFile(File jarSrcFile, File jarFile) throws Exception { + jarFile.delete(); + Files.copy(jarSrcFile.toPath(), jarFile.toPath()); + + File dir = new File(System.getProperty("test.classes", ".")); + File outdir = new File(dir, "old_class_test_classes"); + outdir.delete(); + outdir.mkdir(); + + writeClassFile(new File(outdir, "Hello.class"), makeOldHello()); + + JarBuilder.update(jarFile.getPath(), outdir.getPath()); + } + + static void writeClassFile(File file, byte bytecodes[]) throws Exception { + try (FileOutputStream fos = new FileOutputStream(file)) { + fos.write(bytecodes); + } + } + +/* makeOldHello() was obtained using JDK8. We use a method name > 128 that would + trigger a call to java.lang.Character.isJavaIdentifierStart() during class + file parsing. + +cat > Hello.java <", "()V", null, null); + mv.visitCode(); + mv.visitVarInsn(ALOAD, 0); + mv.visitMethodInsn(INVOKESPECIAL, "java/lang/Object", "", "()V", false); + mv.visitInsn(RETURN); + mv.visitMaxs(1, 1); + mv.visitEnd(); + } + { + mv = cw.visitMethod(ACC_PUBLIC + ACC_STATIC, "main", "([Ljava/lang/String;)V", null, null); + mv.visitCode(); + mv.visitFieldInsn(GETSTATIC, "java/lang/System", "out", "Ljava/io/PrintStream;"); + mv.visitMethodInsn(INVOKESTATIC, "Hello", "\u1234", "()Ljava/lang/String;", false); + mv.visitMethodInsn(INVOKEVIRTUAL, "java/io/PrintStream", "println", "(Ljava/lang/String;)V", false); + mv.visitInsn(RETURN); + mv.visitMaxs(2, 1); + mv.visitEnd(); + } + { + mv = cw.visitMethod(ACC_STATIC, "\u1234", "()Ljava/lang/String;", null, null); + mv.visitCode(); + mv.visitLdcInsn("Hello Unicode world (Old)"); + mv.visitInsn(ARETURN); + mv.visitMaxs(1, 0); + mv.visitEnd(); + } + cw.visitEnd(); + + return cw.toByteArray(); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/PackageSealing.java b/test/hotspot/jtreg/runtime/appcds/PackageSealing.java new file mode 100644 index 00000000000..00651ee0a3f --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/PackageSealing.java @@ -0,0 +1,60 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary AppCDS handling of package. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * @compile test-classes/C1.java + * @compile test-classes/C2.java + * @compile test-classes/PackageSealingTest.java + * @run main PackageSealing + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class PackageSealing { + public static void main(String args[]) throws Exception { + String[] classList = {"sealed/pkg/C1", "pkg/C2", "PackageSealingTest"}; + String appJar = ClassFileInstaller.writeJar("pkg_seal.jar", + ClassFileInstaller.Manifest.fromSourceFile("test-classes/package_seal.mf"), + "PackageSealingTest", "sealed/pkg/C1", "pkg/C2"); + + // test shared package from -cp path + TestCommon.testDump(appJar, TestCommon.list(classList)); + OutputAnalyzer output; + output = TestCommon.exec(appJar, "PackageSealingTest"); + TestCommon.checkExec(output, "OK"); + + // test shared package from -Xbootclasspath/a + TestCommon.dump(appJar, TestCommon.list(classList), + "-Xbootclasspath/a:" + appJar); + output = TestCommon.exec(appJar, "-Xbootclasspath/a:" + appJar, "PackageSealingTest"); + TestCommon.checkExec(output, "OK"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/ParallelLoad2.java b/test/hotspot/jtreg/runtime/appcds/ParallelLoad2.java new file mode 100644 index 00000000000..6c07c6bebce --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/ParallelLoad2.java @@ -0,0 +1,64 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Load app classes from CDS archive in parallel threads. Similar to ParallelLoad.java, but each class in its own JAR + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/ParallelLoad.java + * @compile test-classes/ParallelClasses.java + * @run main ParallelLoad2 + */ + +import java.io.File; + +public class ParallelLoad2 { + public static int MAX_CLASSES = 40; + public static void main(String[] args) throws Exception { + JarBuilder.build("parallel_load2", "ParallelLoad", "ParallelLoadThread", "ParallelLoadWatchdog"); + for (int i=0; i---------------------------------------------------------------------"); + System.out.println(msg); + System.out.println("<---------------------------------------------------------------------"); + } + + public static void main(String[] args) throws Exception { + String appJar = JarBuilder.getOrCreateHelloJar(); + String appJar2 = JarBuilder.build("PrintSharedArchiveAndExit-more", "HelloMore"); + + String cp = appJar + File.pathSeparator + appJar2; + String lastCheckMsg = "checking shared classpath entry: " + appJar2; // the last JAR to check + + TestCommon.testDump(cp, TestCommon.list("Hello")); + + OutputAnalyzer output; + + log("Normal execution -- all the JAR paths should be checked"); + output = TestCommon.execCommon( + "-cp", cp, + "-XX:+PrintSharedArchiveAndExit"); + check(output, 0, true, lastCheckMsg); + + output = TestCommon.execCommon( + "-cp", cp, + "-XX:+PrintSharedArchiveAndExit", + "-XX:+PrintSharedDictionary"); // Test PrintSharedDictionary as well. + check(output, 0, true, lastCheckMsg, "java.lang.Object"); + + log("Normal execution -- Make sure -version, help message and app main()\n" + + "class are not invoked. These are checked inside check()."); + output = TestCommon.execCommon("-cp", cp, "-XX:+PrintSharedArchiveAndExit", "-version"); + check(output, 0, true, lastCheckMsg); + + output = TestCommon.execCommon("-cp", cp, "-XX:+PrintSharedArchiveAndExit", "-help"); + check(output, 0, true, lastCheckMsg); + + output = TestCommon.execCommon("-cp", cp, "-XX:+PrintSharedArchiveAndExit", "Hello"); + check(output, 0, true, lastCheckMsg); + + log("Execution with simple errors -- with 'simple' errors like missing or modified\n" + + "JAR files, the VM should try to continue to print the remaining information.\n" + + "Use an invalid Boot CP -- all the JAR paths should be checked"); + output = TestCommon.execCommon( + "-cp", cp, + "-Xbootclasspath/a:foo.jar", + "-XX:+PrintSharedArchiveAndExit"); + check(output, 1, true, lastCheckMsg, "[BOOT classpath mismatch, "); + + log("Use an App CP shorter than the one at dump time -- all the JAR paths should be checked"); + output = TestCommon.execCommon( + "-cp", ".", + "-XX:+PrintSharedArchiveAndExit"); + check(output, 1, true, lastCheckMsg, "Run time APP classpath is shorter than the one at dump time: ."); + + log("Use an invalid App CP -- all the JAR paths should be checked"); + String invalidCP = "non-existing-dir" + File.pathSeparator + cp; + output = TestCommon.execCommon( + "-cp", invalidCP, + "-XX:+PrintSharedArchiveAndExit"); + check(output, 1, true, lastCheckMsg, "APP classpath mismatch, actual: -Djava.class.path=" + invalidCP); + + log("Changed modification time of hello.jar -- all the JAR paths should be checked"); + (new File(appJar)).setLastModified(System.currentTimeMillis() + 2000); + output = TestCommon.execCommon( + "-cp", cp, + "-XX:+PrintSharedArchiveAndExit"); + check(output, 1, true, lastCheckMsg, "[Timestamp mismatch]"); + + log("Even if hello.jar is out of date, we should still be able to print the dictionary."); + output = TestCommon.execCommon( + "-cp", cp, + "-XX:+PrintSharedArchiveAndExit", + "-XX:+PrintSharedDictionary"); // Test PrintSharedDictionary as well. + check(output, 1, true, lastCheckMsg, "java.lang.Object"); + + + log("Remove hello.jar -- all the JAR paths should be checked"); + (new File(appJar)).delete(); + output = TestCommon.execCommon( + "-cp", cp, + "-XX:+PrintSharedArchiveAndExit"); + check(output, 1, true, lastCheckMsg, "[Required classpath entry does not exist: " + appJar + "]"); + + log("Execution with major errors -- with 'major' errors like the JSA file\n" + + "is missing, we should stop immediately to avoid crashing the JVM."); + output = TestCommon.execCommon( + "-cp", cp, + "-XX:+PrintSharedArchiveAndExit", + "-XX:SharedArchiveFile=./no-such-fileappcds.jsa"); + check(output, 1, false, lastCheckMsg); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/ProhibitedPackage.java b/test/hotspot/jtreg/runtime/appcds/ProhibitedPackage.java new file mode 100644 index 00000000000..33ea5a33f0c --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/ProhibitedPackage.java @@ -0,0 +1,101 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary AppCDS handling of prohibited package. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/ProhibitedHelper.java test-classes/Prohibited.jasm + * @run main ProhibitedPackage + */ + +import jdk.test.lib.Platform; +import jdk.test.lib.process.OutputAnalyzer; + +public class ProhibitedPackage { + + public static void main(String[] args) throws Exception { + JarBuilder.build("prohibited_pkg", "java/lang/Prohibited", "ProhibitedHelper"); + + String appJar = TestCommon.getTestJar("prohibited_pkg.jar"); + + // AppCDS for custom loader is only supported on linux-x64 and + // Solaris 64-bit platforms. + if ((Platform.isLinux() || Platform.isSolaris()) && + Platform.is64bit()) { + String classlist[] = new String[] { + "java/lang/Object id: 1", + "java/lang/Prohibited id: 2 super: 1 source: " + appJar + }; + + // Make sure a class in a prohibited package for a custom loader + // will be ignored during dumping. + TestCommon.dump(appJar, + classlist, + "-XX:+PrintSystemDictionaryAtExit") + .shouldContain("Dumping") + .shouldNotContain("java.lang.Prohibited") + .shouldHaveExitValue(0); + } + + + // Make sure a class in a prohibited package for a non-custom loader + // will be ignored during dumping. + TestCommon.dump(appJar, + TestCommon.list("java/lang/Prohibited", "ProhibitedHelper"), + "-XX:+PrintSystemDictionaryAtExit") + .shouldContain("Dumping") + .shouldNotContain("java.lang.Prohibited") + .shouldHaveExitValue(0); + + // Try loading the class in a prohibited package with various -Xshare + // modes. The class shouldn't be loaded and appropriate exceptions + // are expected. + + OutputAnalyzer output; + + // -Xshare:on + output = TestCommon.execCommon( + "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI", + "-cp", appJar, "-Xlog:class+load=info", "ProhibitedHelper"); + TestCommon.checkExec(output, "Prohibited package name: java.lang"); + + // -Xshare:auto + output = TestCommon.execAuto( + "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI", + "-cp", appJar, "-Xlog:class+load=info", "ProhibitedHelper"); + TestCommon.checkExec(output, "Prohibited package name: java.lang"); + + // -Xshare:off + output = TestCommon.execOff( + "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI", + "-cp", appJar, "-Xlog:class+load=info", "ProhibitedHelper"); + output.shouldContain("Prohibited package name: java.lang"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/ProtectionDomain.java b/test/hotspot/jtreg/runtime/appcds/ProtectionDomain.java new file mode 100644 index 00000000000..2ff23525a1a --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/ProtectionDomain.java @@ -0,0 +1,73 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary AppCDS handling of protection domain. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/ProtDomain.java + * @compile test-classes/ProtDomainB.java + * @compile test-classes/JimageClassProtDomain.java + * @run main ProtectionDomain + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class ProtectionDomain { + public static void main(String[] args) throws Exception { + JarBuilder.build("prot_domain", "ProtDomain", "ProtDomainB", "ProtDomainOther", + "ProtDomainBOther", "JimageClassProtDomain"); + + String appJar = TestCommon.getTestJar("prot_domain.jar"); + TestCommon.testDump(appJar, + TestCommon.list("ProtDomain", + "ProtDomainBOther", + "java/util/Dictionary", + "sun/tools/javac/Main", + "jdk/nio/zipfs/ZipInfo", + "java/net/URL", + "sun/rmi/rmic/Main", + "com/sun/jndi/dns/DnsName")); + + OutputAnalyzer output; + + // First class is loaded from CDS, second class is loaded from JAR + output = TestCommon.exec(appJar, "-verbose:class", "ProtDomain"); + TestCommon.checkExec(output, "Protection Domains match"); + + // First class is loaded from JAR, second class is loaded from CDS + output = TestCommon.exec(appJar, "-verbose:class", "ProtDomainB"); + TestCommon.checkExec(output, "Protection Domains match"); + + // Test ProtectionDomain for application and extension module classes from the + // "modules" jimage + output = TestCommon.exec(appJar, "-verbose:class", "JimageClassProtDomain"); + output.shouldNotContain("Failed: Protection Domains do not match"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/RewriteBytecodesTest.java b/test/hotspot/jtreg/runtime/appcds/RewriteBytecodesTest.java new file mode 100644 index 00000000000..d49587d6bce --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/RewriteBytecodesTest.java @@ -0,0 +1,65 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Use ClassLoader.defineClass() to load a class with rewritten bytecode. Make sure + * the archived class with the same name is not loaded. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/RewriteBytecodes.java test-classes/Util.java test-classes/Super.java test-classes/Child.java + * @build sun.hotspot.WhiteBox + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @run main RewriteBytecodesTest + */ + +import java.io.File; +import jdk.test.lib.process.OutputAnalyzer; + +public class RewriteBytecodesTest { + public static void main(String[] args) throws Exception { + String wbJar = JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox"); + String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar; + + String appJar = JarBuilder.build("dynamic_define", "RewriteBytecodes", "Util", "Super", "Child"); + String superClsFile = (new File(System.getProperty("test.classes", "."), "Super.class")).getPath(); + + TestCommon.dump(appJar, TestCommon.list("RewriteBytecodes", "Super", "Child"), + // command-line arguments ... + use_whitebox_jar); + + OutputAnalyzer output = TestCommon.exec(appJar, + // command-line arguments ... + "--add-opens=java.base/java.lang=ALL-UNNAMED", + use_whitebox_jar, + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", + "RewriteBytecodes", superClsFile); + TestCommon.checkExec(output); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/SharedArchiveConsistency.java b/test/hotspot/jtreg/runtime/appcds/SharedArchiveConsistency.java new file mode 100644 index 00000000000..e7b1dac98ed --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/SharedArchiveConsistency.java @@ -0,0 +1,386 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary SharedArchiveConsistency + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.compiler + * java.management + * jdk.jartool/sun.tools.jar + * jdk.internal.jvmstat/sun.jvmstat.monitor + * @build sun.hotspot.WhiteBox + * @compile test-classes/Hello.java + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @run main/othervm -Xbootclasspath/a:. -XX:+UnlockDiagnosticVMOptions -XX:+WhiteBoxAPI SharedArchiveConsistency + */ +import jdk.test.lib.process.OutputAnalyzer; +import jdk.test.lib.Utils; +import java.io.File; +import java.io.FileInputStream; +import java.io.FileOutputStream; +import java.io.IOException; +import java.nio.ByteBuffer; +import java.nio.ByteOrder; +import java.nio.channels.FileChannel; +import java.nio.file.Files; +import java.nio.file.Path; +import java.nio.file.Paths; +import static java.nio.file.StandardCopyOption.REPLACE_EXISTING; +import java.nio.file.StandardOpenOption; +import static java.nio.file.StandardOpenOption.READ; +import static java.nio.file.StandardOpenOption.WRITE; +import java.util.ArrayList; +import java.util.HashSet; +import java.util.List; +import java.util.Random; +import sun.hotspot.WhiteBox; + +public class SharedArchiveConsistency { + public static WhiteBox wb; + public static int offset_magic; // FileMapHeader::_magic + public static int sp_offset_crc; // FileMapHeader::space_info::_crc + public static int file_header_size = -1;// total size of header, variant, need calculation + public static int space_info_size; // size of space_info + public static int sp_offset; // offset of FileMapHeader::space_info + public static int sp_used_offset; // offset of space_info::_used + public static int size_t_size; // size of size_t + + public static File jsa; // will be updated during test + public static File orgJsaFile; // kept the original file not touched. + public static String[] shared_region_name = {"MiscCode", "ReadWrite", "ReadOnly", "MiscData"}; + public static int num_regions = shared_region_name.length; + public static String[] matchMessages = { + "Unable to use shared archive", + "An error has occurred while processing the shared archive file.", + "Checksum verification failed.", + "The shared archive file has been truncated." + }; + + public static void getFileOffsetInfo() throws Exception { + wb = WhiteBox.getWhiteBox(); + offset_magic = wb.getOffsetForName("FileMapHeader::_magic"); + sp_offset_crc = wb.getOffsetForName("space_info::_crc"); + try { + int nonExistOffset = wb.getOffsetForName("FileMapHeader::_non_exist_offset"); + System.exit(-1); // should fail + } catch (Exception e) { + // success + } + + sp_offset = wb.getOffsetForName("FileMapHeader::_space[0]") - offset_magic; + sp_used_offset = wb.getOffsetForName("space_info::_used") - sp_offset_crc; + size_t_size = wb.getOffsetForName("size_t_size"); + space_info_size = wb.getOffsetForName("space_info_size"); + } + + public static int getFileHeaderSize(FileChannel fc) throws Exception { + if (file_header_size != -1) { + return file_header_size; + } + // this is not real header size, it is struct size + file_header_size = wb.getOffsetForName("file_header_size"); + int offset_path_misc_info = wb.getOffsetForName("FileMapHeader::_paths_misc_info_size") - + offset_magic; + int path_misc_info_size = (int)readInt(fc, offset_path_misc_info, size_t_size); + file_header_size += path_misc_info_size; //readInt(fc, offset_path_misc_info, size_t_size); + System.out.println("offset_path_misc_info = " + offset_path_misc_info); + System.out.println("path_misc_info_size = " + path_misc_info_size); + System.out.println("file_header_size = " + file_header_size); + file_header_size = (int)align_up_page(file_header_size); + System.out.println("file_header_size (aligned to page) = " + file_header_size); + return file_header_size; + } + + public static long align_up_page(long l) throws Exception { + // wb is obtained in getFileOffsetInfo() which is called first in main() else we should call + // WhiteBox.getWhiteBox() here first. + int pageSize = wb.getVMPageSize(); + return (l + pageSize -1) & (~ (pageSize - 1)); + } + + private static long getRandomBetween(long start, long end) throws Exception { + if (start > end) { + throw new IllegalArgumentException("start must be less than end"); + } + Random aRandom = Utils.getRandomInstance(); + int d = aRandom.nextInt((int)(end - start)); + if (d < 1) { + d = 1; + } + return start + d; + } + + public static long readInt(FileChannel fc, long offset, int nbytes) throws Exception { + ByteBuffer bb = ByteBuffer.allocate(nbytes); + bb.order(ByteOrder.nativeOrder()); + fc.position(offset); + fc.read(bb); + return (nbytes > 4 ? bb.getLong(0) : bb.getInt(0)); + } + + public static void writeData(FileChannel fc, long offset, ByteBuffer bb) throws Exception { + fc.position(offset); + fc.write(bb); + fc.force(true); + } + + public static FileChannel getFileChannel() throws Exception { + List arry = new ArrayList(); + arry.add(READ); + arry.add(WRITE); + return FileChannel.open(jsa.toPath(), new HashSet(arry)); + } + + public static void modifyJsaContentRandomly() throws Exception { + FileChannel fc = getFileChannel(); + // corrupt random area in the data areas (MiscCode, ReadWrite, ReadOnly, MiscData) + long[] used = new long[num_regions]; // record used bytes + long start0, start, end, off; + int used_offset, path_info_size; + + int bufSize; + System.out.printf("%-12s%-12s%-12s%-12s%-12s\n", "Space Name", "Offset", "Used bytes", "Reg Start", "Random Offset"); + start0 = getFileHeaderSize(fc); + for (int i = 0; i < num_regions; i++) { + used_offset = sp_offset + space_info_size * i + sp_used_offset; + // read 'used' + used[i] = readInt(fc, used_offset, size_t_size); + start = start0; + for (int j = 0; j < i; j++) { + start += align_up_page(used[j]); + } + end = start + used[i]; + off = getRandomBetween(start, end); + System.out.printf("%-12s%-12d%-12d%-12d%-12d\n", shared_region_name[i], used_offset, used[i], start, off); + if (end - off < 1024) { + bufSize = (int)(end - off + 1); + } else { + bufSize = 1024; + } + ByteBuffer bbuf = ByteBuffer.wrap(new byte[bufSize]); + writeData(fc, off, bbuf); + } + if (fc.isOpen()) { + fc.close(); + } + } + + public static void modifyJsaContent() throws Exception { + FileChannel fc = getFileChannel(); + byte[] buf = new byte[4096]; + ByteBuffer bbuf = ByteBuffer.wrap(buf); + + long total = 0L; + long used_offset = 0L; + long[] used = new long[num_regions]; + System.out.printf("%-12s%-12s\n", "Space name", "Used bytes"); + for (int i = 0; i < num_regions; i++) { + used_offset = sp_offset + space_info_size* i + sp_used_offset; + // read 'used' + used[i] = readInt(fc, used_offset, size_t_size); + System.out.printf("%-12s%-12d\n", shared_region_name[i], used[i]); + total += used[i]; + } + System.out.printf("%-12s%-12d\n", "Total: ", total); + long corrupt_used_offset = getFileHeaderSize(fc); + System.out.println("Corrupt RO section, offset = " + corrupt_used_offset); + while (used_offset < used[0]) { + writeData(fc, corrupt_used_offset, bbuf); + bbuf.clear(); + used_offset += 4096; + } + fc.force(true); + if (fc.isOpen()) { + fc.close(); + } + } + + public static void modifyJsaHeader() throws Exception { + FileChannel fc = getFileChannel(); + // screw up header info + byte[] buf = new byte[getFileHeaderSize(fc)]; + ByteBuffer bbuf = ByteBuffer.wrap(buf); + writeData(fc, 0L, bbuf); + if (fc.isOpen()) { + fc.close(); + } + } + + public static void copyFile(File from, File to) throws Exception { + if (to.exists()) { + if(!to.delete()) { + throw new IOException("Could not delete file " + to); + } + } + to.createNewFile(); + setReadWritePermission(to); + Files.copy(from.toPath(), to.toPath(), REPLACE_EXISTING); + } + + // Copy file with bytes deleted or inserted + // del -- true, deleted, false, inserted + public static void copyFile(File from, File to, boolean del) throws Exception { + FileChannel inputChannel = null; + FileChannel outputChannel = null; + try { + inputChannel = new FileInputStream(from).getChannel(); + outputChannel = new FileOutputStream(to).getChannel(); + long size = inputChannel.size(); + int init_size = getFileHeaderSize(inputChannel); + outputChannel.transferFrom(inputChannel, 0, init_size); + int n = (int)getRandomBetween(0, 1024); + if (del) { + System.out.println("Delete " + n + " bytes at data start section"); + inputChannel.position(init_size + n); + outputChannel.transferFrom(inputChannel, init_size, size - init_size - n); + } else { + System.out.println("Insert " + n + " bytes at data start section"); + outputChannel.position(init_size); + outputChannel.write(ByteBuffer.wrap(new byte[n])); + outputChannel.transferFrom(inputChannel, init_size + n , size - init_size); + } + } finally { + inputChannel.close(); + outputChannel.close(); + } + } + + public static void restoreJsaFile() throws Exception { + Files.copy(orgJsaFile.toPath(), jsa.toPath(), REPLACE_EXISTING); + } + + public static void setReadWritePermission(File file) throws Exception { + if (!file.canRead()) { + if (!file.setReadable(true)) { + throw new IOException("Cannot modify file " + file + " as readable"); + } + } + if (!file.canWrite()) { + if (!file.setWritable(true)) { + throw new IOException("Cannot modify file " + file + " as writable"); + } + } + } + + public static void testAndCheck(String[] execArgs) throws Exception { + OutputAnalyzer output = TestCommon.execCommon(execArgs); + String stdtxt = output.getOutput(); + System.out.println("Note: this test may fail in very rare occasions due to CRC32 checksum collision"); + for (String message : matchMessages) { + if (stdtxt.contains(message)) { + // match any to return + return; + } + } + TestCommon.checkExec(output); + } + + // dump with hello.jsa, then + // read the jsa file + // 1) run normal + // 2) modify header + // 3) keep header correct but modify content + // 4) update both header and content, test + // 5) delete bytes in data begining + // 6) insert bytes in data begining + // 7) randomly corrupt data in four areas: RO, RW. MISC DATA, MISC CODE + public static void main(String... args) throws Exception { + // must call to get offset info first!!! + getFileOffsetInfo(); + Path currentRelativePath = Paths.get(""); + String currentDir = currentRelativePath.toAbsolutePath().toString(); + System.out.println("Current relative path is: " + currentDir); + // get jar file + String jarFile = JarBuilder.getOrCreateHelloJar(); + + // dump (appcds.jsa created) + TestCommon.testDump(jarFile, null); + + // test, should pass + System.out.println("1. Normal, should pass but may fail\n"); + String[] execArgs = {"-cp", jarFile, "Hello"}; + + OutputAnalyzer output = TestCommon.execCommon(execArgs); + + try { + TestCommon.checkExecReturn(output, 0, true, "Hello World"); + } catch (Exception e) { + TestCommon.checkExecReturn(output, 1, true, matchMessages[0]); + } + + // get current archive name + jsa = new File(TestCommon.getCurrentArchiveName()); + if (!jsa.exists()) { + throw new IOException(jsa + " does not exist!"); + } + + setReadWritePermission(jsa); + + // save as original untouched + orgJsaFile = new File(new File(currentDir), "appcds.jsa.bak"); + copyFile(jsa, orgJsaFile); + + + // modify jsa header, test should fail + System.out.println("\n2. Corrupt header, should fail\n"); + modifyJsaHeader(); + output = TestCommon.execCommon(execArgs); + output.shouldContain("The shared archive file has the wrong version"); + output.shouldNotContain("Checksum verification failed"); + + // modify content + System.out.println("\n3. Corrupt Content, should fail\n"); + copyFile(orgJsaFile, jsa); + modifyJsaContent(); + testAndCheck(execArgs); + + // modify both header and content, test should fail + System.out.println("\n4. Corrupt Header and Content, should fail\n"); + copyFile(orgJsaFile, jsa); + modifyJsaHeader(); + modifyJsaContent(); // this will not be reached since failed on header change first + output = TestCommon.execCommon(execArgs); + output.shouldContain("The shared archive file has the wrong version"); + output.shouldNotContain("Checksum verification failed"); + + // delete bytes in data sectoin + System.out.println("\n5. Delete bytes at begining of data section, should fail\n"); + copyFile(orgJsaFile, jsa, true); + testAndCheck(execArgs); + + // insert bytes in data sectoin forward + System.out.println("\n6. Insert bytes at begining of data section, should fail\n"); + copyFile(orgJsaFile, jsa, false); + testAndCheck(execArgs); + + System.out.println("\n7. modify Content in random areas, should fail\n"); + copyFile(orgJsaFile, jsa); + modifyJsaContentRandomly(); + testAndCheck(execArgs); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/SharedArchiveFile.java b/test/hotspot/jtreg/runtime/appcds/SharedArchiveFile.java new file mode 100644 index 00000000000..f18b5f21880 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/SharedArchiveFile.java @@ -0,0 +1,83 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ +/* + * @test + * @summary The diagnostic option, -XX:SharedArchiveFile can be unlocked using -XX:+UseAppCDS + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java + * @run main SharedArchiveFile + */ + +import jdk.test.lib.Platform; +import jdk.test.lib.cds.CDSTestUtils; +import jdk.test.lib.process.OutputAnalyzer; +import jdk.test.lib.process.ProcessTools; +import java.util.Properties; + +public class SharedArchiveFile { + public static void main(String[] args) throws Exception { + boolean isProduct = !Platform.isDebugBuild(); + String appJar = JarBuilder.getOrCreateHelloJar(); + + // 1) Using -XX:SharedArchiveFile without -XX:+UseAppCDS should fail + // on product binary without -XX:+UnlockDiagnosticVMOptions. + if (isProduct) { + ProcessBuilder pb = ProcessTools.createJavaProcessBuilder(true, + "-XX:SharedArchiveFile=./SharedArchiveFile.jsa", "-Xshare:dump"); + OutputAnalyzer out = CDSTestUtils.executeAndLog(pb, "dump"); + out.shouldContain("Error: VM option 'SharedArchiveFile' is diagnostic and must be enabled via -XX:+UnlockDiagnosticVMOptions."); + } + + // 2) Dumping with -XX:+UnlockDiagnosticVMOptions -XX:SharedArchiveFile + // should always succeed. + CDSTestUtils.createArchive("-XX:+UnlockDiagnosticVMOptions") + .shouldContain("Dumping"); + + // 3) Using -XX:SharedArchiveFile with -XX:+UseAppCDS should work + // on product binary by default. + OutputAnalyzer output3 = TestCommon.dump(appJar, TestCommon.list("Hello")); + output3.shouldContain("Dumping"); + output3 = TestCommon.exec(appJar, "Hello"); + TestCommon.checkExec(output3, "Hello World"); + + // 4) Using -XX:+UseAppCDS should not affect other diagnostic flags, + // such as LogEvents + OutputAnalyzer output4 = TestCommon.exec(appJar, "-XX:+LogEvents", "Hello"); + if (isProduct) { + output4.shouldContain("Error: VM option 'LogEvents' is diagnostic and must be enabled via -XX:+UnlockDiagnosticVMOptions."); + } else { + TestCommon.checkExec(output4, "Hello World"); + } + + // 5) 8066921 - Extra -XX:+UseAppCDS + TestCommon.testDump(appJar, TestCommon.list("Hello"), "-XX:+UseAppCDS"); + OutputAnalyzer output5 = TestCommon.exec(appJar, "-XX:+UseAppCDS", "Hello"); + TestCommon.checkExec(output5); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/SharedBaseAddress.java b/test/hotspot/jtreg/runtime/appcds/SharedBaseAddress.java new file mode 100644 index 00000000000..b317aac0d8f --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/SharedBaseAddress.java @@ -0,0 +1,65 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test SharedBaseAddress + * @summary Test variety of values for SharedBaseAddress, in AppCDS mode, + * making sure VM handles normal values as well as edge values + * w/o a crash. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java + * @run main/timeout=240 SharedBaseAddress + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class SharedBaseAddress { + + // shared base address test table + private static final String[] testTable = { + "1g", "8g", "64g","512g", "4t", + "32t", "128t", "0", + "1", "64k", "64M" + }; + + public static void main(String[] args) throws Exception { + String appJar = JarBuilder.getOrCreateHelloJar(); + + for (String testEntry : testTable) { + System.out.println("sharedBaseAddress = " + testEntry); + + OutputAnalyzer dumpOutput = TestCommon.dump( + appJar, new String[] {"Hello"}, "-XX:SharedBaseAddress=" + testEntry); + TestCommon.checkDump(dumpOutput, "Loading classes to share"); + + OutputAnalyzer execOutput = TestCommon.exec(appJar, "Hello"); + TestCommon.checkExec(execOutput, "Hello World"); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/SharedPackages.java b/test/hotspot/jtreg/runtime/appcds/SharedPackages.java new file mode 100644 index 00000000000..c748d53c39c --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/SharedPackages.java @@ -0,0 +1,79 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary AppCDS handling of package. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/PackageTest.java + * @compile test-classes/JimageClassPackage.java + * @run main SharedPackages + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class SharedPackages { + public static void main(String[] args) throws Exception { + JarBuilder.build("pkg", "p/PackageTest", "JimageClassPackage"); + + String appJar = TestCommon.getTestJar("pkg.jar"); + TestCommon.testDump(appJar, TestCommon.list("p/PackageTest", + "java/util/Dictionary", + "sun/tools/javac/Main", + "jdk/nio/zipfs/ZipInfo", + "java/net/URL", + "sun/rmi/rmic/Main", + "com/sun/jndi/dns/DnsName")); + + OutputAnalyzer output; + + // Test 1: shared class from Jar on the -cp + output = TestCommon.exec(appJar, "-verbose:class", "p.PackageTest"); + TestCommon.checkExec(output, "Expected package"); + if (!TestCommon.isUnableToMap(output)) + output.shouldContain("Package is not sealed"); + + // Test 2: shared classes from "modules" jimage + output = TestCommon.exec(appJar, "-verbose:class", + "JimageClassPackage"); + if (!TestCommon.isUnableToMap(output)) { + output.shouldNotContain("Unexpected package"); + output.shouldNotContain("Package is not sealed"); + } + + // Test 3: shared class from Jar on the -Xbootclasspath/a + TestCommon.dump( + appJar, TestCommon.list("p/PackageTest"), "-Xbootclasspath/a:" + appJar); + output = TestCommon.exec(appJar, "-Xbootclasspath/a:" + appJar, "p.PackageTest"); + if (!TestCommon.isUnableToMap(output)) { + output.shouldNotContain("Unexpected package"); + output.shouldContain("Package is not sealed"); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/SignedJar.java b/test/hotspot/jtreg/runtime/appcds/SignedJar.java new file mode 100644 index 00000000000..7c3391ea034 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/SignedJar.java @@ -0,0 +1,69 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary AppCDS handling of signed JAR. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java + * @run main SignedJar + */ + +import jdk.test.lib.process.OutputAnalyzer; +import java.io.File; + +public class SignedJar { + public static void main(String[] args) throws Exception { + String unsignedJar = JarBuilder.getOrCreateHelloJar(); + JarBuilder.signJar(); + + // Test class exists in signed JAR + String signedJar = TestCommon.getTestJar("signed_hello.jar"); + OutputAnalyzer output; + output = TestCommon.dump(signedJar, TestCommon.list("Hello")); + TestCommon.checkDump(output, "Preload Warning: Skipping Hello from signed JAR"); + + // At runtime, the Hello class should be loaded from the jar file + // instead of from the shared archive since a class from a signed + // jar shouldn't be dumped into the archive. + output = TestCommon.exec(signedJar, "-verbose:class", "Hello"); + String expectedOutput = ".class,load. Hello source: file:.*signed_hello.jar"; + + try { + output.shouldMatch(expectedOutput); + } catch (Exception e) { + TestCommon.checkCommonExecExceptions(output, e); + } + + // Test class exists in both signed JAR and unsigned JAR + String jars = signedJar + System.getProperty("path.separator") + unsignedJar; + output = TestCommon.dump(jars, TestCommon.list("Hello")); + TestCommon.checkDump(output, "Preload Warning: Skipping Hello from signed JAR"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/SpecifySysLoaderProp.java b/test/hotspot/jtreg/runtime/appcds/SpecifySysLoaderProp.java new file mode 100644 index 00000000000..bea6a0ac3f0 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/SpecifySysLoaderProp.java @@ -0,0 +1,107 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary If -Djava.system.class.loader=xxx is specified in command-line, disable UseAppCDS + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * @compile test-classes/TestClassLoader.java + * @compile test-classes/ReportMyLoader.java + * @compile test-classes/TrySwitchMyLoader.java + * @run main SpecifySysLoaderProp + */ + +import java.io.*; +import jdk.test.lib.process.OutputAnalyzer; + +public class SpecifySysLoaderProp { + + public static void main(String[] args) throws Exception { + JarBuilder.build("sysloader", "TestClassLoader", "ReportMyLoader", "TrySwitchMyLoader"); + + String jarFileName = "sysloader.jar"; + String appJar = TestCommon.getTestJar(jarFileName); + TestCommon.testDump(appJar, TestCommon.list("ReportMyLoader")); + String warning = "VM warning: UseAppCDS is disabled because the java.system.class.loader property is specified"; + + + // (0) Baseline. Do not specify -Djava.system.class.loader + // The test class should be loaded from archive + OutputAnalyzer output = TestCommon.execCommon( + "-verbose:class", + "-cp", appJar, + "ReportMyLoader"); + TestCommon.checkExec(output, + "[class,load] ReportMyLoader source: shared objects file", + "ReportMyLoader's loader = jdk.internal.loader.ClassLoaders$AppClassLoader@"); + + // (1) Try to execute the archive with -Djava.system.class.loader=no.such.Klass, + // it should fail + output = TestCommon.execCommon( + "-cp", appJar, + "-Djava.system.class.loader=no.such.Klass", + "ReportMyLoader"); + try { + output.shouldContain(warning); + output.shouldContain("ClassNotFoundException: no.such.Klass"); + } catch (Exception e) { + TestCommon.checkCommonExecExceptions(output, e); + } + + // (2) Try to execute the archive with -Djava.system.class.loader=TestClassLoader, + // it should run, but AppCDS should be disabled + output = TestCommon.execCommon( + "-verbose:class", + "-cp", appJar, + "-Djava.system.class.loader=TestClassLoader", + "ReportMyLoader"); + TestCommon.checkExec(output, + "ReportMyLoader's loader = jdk.internal.loader.ClassLoaders$AppClassLoader@", //<-this is still printed because TestClassLoader simply delegates to Launcher$AppLoader, but ... + "TestClassLoader.called = true", //<-but this proves that TestClassLoader was indeed called. + "TestClassLoader: loadClass(\"ReportMyLoader\","); //<- this also proves that TestClassLoader was indeed called. + try { + output.shouldMatch(".class,load. TestClassLoader source: file:"); + output.shouldMatch(".class,load. ReportMyLoader source: file:.*" + jarFileName); + } catch (Exception e) { + TestCommon.checkCommonExecExceptions(output, e); + } + + // (3) Try to change the java.system.class.loader programmatically after + // the app's main method is executed. This should have no effect in terms of + // changing or switching the actual system class loader that's already in use. + output = TestCommon.execCommon( + "-verbose:class", + "-cp", appJar, + "TrySwitchMyLoader"); + TestCommon.checkExec(output, + "[class,load] ReportMyLoader source: shared objects file", + "TrySwitchMyLoader's loader = jdk.internal.loader.ClassLoaders$AppClassLoader@", + "ReportMyLoader's loader = jdk.internal.loader.ClassLoaders$AppClassLoader@", + "TestClassLoader.called = false"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/TestCommon.java b/test/hotspot/jtreg/runtime/appcds/TestCommon.java new file mode 100644 index 00000000000..882b235d1cd --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/TestCommon.java @@ -0,0 +1,339 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import jdk.test.lib.Utils; +import jdk.test.lib.JDKToolFinder; +import jdk.test.lib.Platform; +import jdk.test.lib.cds.CDSOptions; +import jdk.test.lib.cds.CDSTestUtils; +import jdk.test.lib.process.ProcessTools; +import jdk.test.lib.process.OutputAnalyzer; +import java.io.File; +import java.text.SimpleDateFormat; +import java.util.ArrayList; +import java.util.Date; + +/** + * This is a test utility class for common AppCDS test functionality. + * + * Various methods use (String ...) for passing VM options. Note that the order + * of the VM options are important in certain cases. Many methods take arguments like + * + * (String prefix[], String suffix[], String... opts) + * + * Note that the order of the VM options is: + * + * prefix + opts + suffix + */ +public class TestCommon extends CDSTestUtils { + private static final String JSA_FILE_PREFIX = System.getProperty("user.dir") + + File.separator + "appcds-"; + + private static final SimpleDateFormat timeStampFormat = + new SimpleDateFormat("HH'h'mm'm'ss's'SSS"); + + private static final String timeoutFactor = + System.getProperty("test.timeout.factor", "1.0"); + + private static String currentArchiveName; + + // Call this method to start new archive with new unique name + public static void startNewArchiveName() { + deletePriorArchives(); + currentArchiveName = JSA_FILE_PREFIX + + timeStampFormat.format(new Date()) + ".jsa"; + } + + // Call this method to get current archive name + public static String getCurrentArchiveName() { + return currentArchiveName; + } + + // Attempt to clean old archives to preserve space + // Archives are large artifacts (20Mb or more), and much larger than + // most other artifacts created in jtreg testing. + // Therefore it is a good idea to clean the old archives when they are not needed. + // In most cases the deletion attempt will succeed; on rare occasion the + // delete operation will fail since the system or VM process still holds a handle + // to the file; in such cases the File.delete() operation will silently fail, w/o + // throwing an exception, thus allowing testing to continue. + public static void deletePriorArchives() { + File dir = new File(System.getProperty("user.dir")); + String files[] = dir.list(); + for (String name : files) { + if (name.startsWith("appcds-") && name.endsWith(".jsa")) { + if (!(new File(dir, name)).delete()) + System.out.println("deletePriorArchives(): delete failed for file " + name); + } + } + } + + + // Create AppCDS archive using most common args - convenience method + // Legacy name preserved for compatibility + public static OutputAnalyzer dump(String appJar, String appClasses[], + String... suffix) throws Exception { + return createArchive(appJar, appClasses, suffix); + } + + + // Create AppCDS archive using most common args - convenience method + public static OutputAnalyzer createArchive(String appJar, String appClasses[], + String... suffix) throws Exception { + AppCDSOptions opts = (new AppCDSOptions()).setAppJar(appJar) + .setAppClasses(appClasses); + opts.addSuffix(suffix); + return createArchive(opts); + } + + + // Create AppCDS archive using appcds options + public static OutputAnalyzer createArchive(AppCDSOptions opts) + throws Exception { + + ArrayList cmd = new ArrayList(); + File classList = makeClassList(opts.appClasses); + startNewArchiveName(); + + for (String p : opts.prefix) cmd.add(p); + + if (opts.appJar != null) { + cmd.add("-cp"); + cmd.add(opts.appJar); + } else { + cmd.add("-cp"); + cmd.add("\"\""); + } + + cmd.add("-Xshare:dump"); + cmd.add("-Xlog:cds,cds+hashtables"); + cmd.add("-XX:+UseAppCDS"); + cmd.add("-XX:ExtraSharedClassListFile=" + classList.getPath()); + + if (opts.archiveName == null) + opts.archiveName = getCurrentArchiveName(); + + cmd.add("-XX:SharedArchiveFile=" + opts.archiveName); + + for (String s : opts.suffix) cmd.add(s); + + String[] cmdLine = cmd.toArray(new String[cmd.size()]); + ProcessBuilder pb = ProcessTools.createJavaProcessBuilder(true, cmdLine); + return executeAndLog(pb, "dump"); + } + + + // Execute JVM using AppCDS archive with specified AppCDSOptions + public static OutputAnalyzer runWithArchive(AppCDSOptions opts) + throws Exception { + + ArrayList cmd = new ArrayList(); + + for (String p : opts.prefix) cmd.add(p); + + cmd.add("-Xshare:" + opts.xShareMode); + cmd.add("-XX:+UseAppCDS"); + cmd.add("-showversion"); + cmd.add("-XX:SharedArchiveFile=" + getCurrentArchiveName()); + cmd.add("-Dtest.timeout.factor=" + timeoutFactor); + + if (opts.appJar != null) { + cmd.add("-cp"); + cmd.add(opts.appJar); + } + + for (String s : opts.suffix) cmd.add(s); + + String[] cmdLine = cmd.toArray(new String[cmd.size()]); + ProcessBuilder pb = ProcessTools.createJavaProcessBuilder(true, cmdLine); + return executeAndLog(pb, "exec"); + } + + + public static OutputAnalyzer execCommon(String... suffix) throws Exception { + AppCDSOptions opts = (new AppCDSOptions()); + opts.addSuffix(suffix); + return runWithArchive(opts); + } + + + public static OutputAnalyzer exec(String appJar, String... suffix) throws Exception { + AppCDSOptions opts = (new AppCDSOptions()).setAppJar(appJar); + opts.addSuffix(suffix); + return runWithArchive(opts); + } + + + public static OutputAnalyzer execAuto(String... suffix) throws Exception { + AppCDSOptions opts = (new AppCDSOptions()); + opts.addSuffix(suffix).setXShareMode("auto"); + return runWithArchive(opts); + } + + public static OutputAnalyzer execOff(String... suffix) throws Exception { + AppCDSOptions opts = (new AppCDSOptions()); + opts.addSuffix(suffix).setXShareMode("off"); + return runWithArchive(opts); + } + + public static OutputAnalyzer execModule(String prefix[], String upgrademodulepath, String modulepath, + String mid, String... testClassArgs) + throws Exception { + + AppCDSOptions opts = (new AppCDSOptions()); + + opts.addPrefix(prefix); + if (upgrademodulepath == null) { + opts.addSuffix("-p", modulepath, "-m", mid); + } else { + opts.addSuffix("--upgrade-module-path", upgrademodulepath, + "-p", modulepath, "-m", mid); + } + opts.addSuffix(testClassArgs); + + return runWithArchive(opts); + } + + + // A common operation: dump, then check results + public static OutputAnalyzer testDump(String appJar, String appClasses[], + String... suffix) throws Exception { + OutputAnalyzer output = dump(appJar, appClasses, suffix); + output.shouldContain("Loading classes to share"); + output.shouldHaveExitValue(0); + return output; + } + + + /** + * Simple test -- dump and execute appJar with the given appClasses in classlist. + */ + public static OutputAnalyzer test(String appJar, String appClasses[], String... args) + throws Exception { + testDump(appJar, appClasses); + + OutputAnalyzer output = exec(appJar, args); + return checkExec(output); + } + + + public static OutputAnalyzer checkExecReturn(OutputAnalyzer output, int ret, + boolean checkContain, String... matches) throws Exception { + try { + for (String s : matches) { + if (checkContain) { + output.shouldContain(s); + } else { + output.shouldNotContain(s); + } + } + output.shouldHaveExitValue(ret); + } catch (Exception e) { + checkCommonExecExceptions(output, e); + } + + return output; + } + + + // Convenience concatenation utils + public static String[] list(String ...args) { + return args; + } + + + public static String[] list(String arg, int count) { + ArrayList stringList = new ArrayList(); + for (int i = 0; i < count; i++) { + stringList.add(arg); + } + + String outputArray[] = stringList.toArray(new String[stringList.size()]); + return outputArray; + } + + + public static String[] concat(String... args) { + return list(args); + } + + + public static String[] concat(String prefix[], String... extra) { + ArrayList list = new ArrayList(); + for (String s : prefix) { + list.add(s); + } + for (String s : extra) { + list.add(s); + } + + return list.toArray(new String[list.size()]); + } + + + // ===================== Concatenate paths + public static String concatPaths(String... paths) { + String prefix = ""; + String s = ""; + for (String p : paths) { + s += prefix; + s += p; + prefix = File.pathSeparator; + } + return s; + } + + + public static String getTestJar(String jar) { + File jarFile = CDSTestUtils.getTestArtifact(jar, true); + if (!jarFile.isFile()) { + throw new RuntimeException("Not a regular file: " + jarFile.getPath()); + } + return jarFile.getPath(); + } + + + public static String getTestDir(String d) { + File dirFile = CDSTestUtils.getTestArtifact(d, true); + if (!dirFile.isDirectory()) { + throw new RuntimeException("Not a directory: " + dirFile.getPath()); + } + return dirFile.getPath(); + } + + + // Returns true if custom loader is supported, based on a platform. + // Custom loader AppCDS is only supported for Linux-x64 and Solaris. + public static boolean isCustomLoaderSupported() { + boolean isLinux = Platform.isLinux(); + boolean isX64 = Platform.isX64(); + boolean isSolaris = Platform.isSolaris(); + + System.out.println("isCustomLoaderSupported: isX64 = " + isX64); + System.out.println("isCustomLoaderSupported: isLinux = " + isLinux); + System.out.println("isCustomLoaderSupported: isSolaris = " + isSolaris); + + return ((isX64 && isLinux) || isSolaris); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/TraceLongClasspath.java b/test/hotspot/jtreg/runtime/appcds/TraceLongClasspath.java new file mode 100644 index 00000000000..b3f73278dba --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/TraceLongClasspath.java @@ -0,0 +1,105 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary ensure -XX:+TraceClassPaths showing entire expecting app classpath + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java + * @run main TraceLongClasspath + */ + +import java.io.File; +import jdk.test.lib.process.OutputAnalyzer; + +public class TraceLongClasspath { + + final static String ps = File.pathSeparator; + + public static void main(String[] args) throws Exception { + String appJar = JarBuilder.getOrCreateHelloJar(); + + String longClassPath = + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/user-patch.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/abc-startup.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/modules/features/com.foobar.db.jdbc7-dms.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/jdk/lib/tools.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/aaserver/server/lib/someapps.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/aaserver/../foobar_common/modules/net.xy.batcontrib_1.1.0.0_1-0b3/lib/bat-contrib.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/aaserver/modules/features/foobar.aas.common.kkkkkkkkkkk.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.abc.common.adapters_11.1.1/foobar.abc.common.adapters.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.plane.adapter_12.1.3/foobar.plane.adapter.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/lib/ccccccccar-common.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/communications/modules/config.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/communications/modules/userprefs-config.jar" + ps + + "/scratch/xxxx/yyyy/XXXXXX/aaaaaaaa/xxxxxxx/xxxxxxxx.us.foobar.com/CommonDomain/config/abc-infra" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/qqqqqq-all-1.6.5.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.abc.thread_11.1.1/foobar.abc.thread.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.abc.thread_11.1.1/thread-rrrrrrr-ext-aas.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.abc.adapter_11.1.1/foobar.abc.adapter.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.abc.ccc_11.1.1/foobar.abc.ccc.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/bbb/lib/commons-configuration.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/bbb/lib/commons-lang.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/bbb/lib/commons-logging.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/modules/foobar.wccore/foobar-ppppppp-api.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/modules/foobar.ooo_12.1.3/ooo-manifest.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/modules/internal/features/rrr_aaxyxx_foobar.rrr.aas.classpath.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.abc.thread_11.1.1/rrrrrrrr-api.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/commons-xxx-1.1.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.abc.mgmt_11.1.1/abc-infra-mgmt.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/eee/archives/eee-eee.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/aaserver/common/march/lib/marchnet.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/aaserver/common/march/lib/marchclient.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/aaserver/common/march/lib/march.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/wwcontent/cde/iii/jlib/iiiloader.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/wwcontent/cde/iii/components/xxxxxxyyzzzzz/classes-xxxxxxyyzzzzz.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/wwcontent/cde/iii/components/mmmmmmm/lib/abc_core.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/wwcontent/cde/iii/components/mmmmmmm/lib/abc_codec.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/wwcontent/cde/iii/components/mmmmmmm/lib/abc_imageio.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/jdk/lib/tools.jar" + ps + + "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/modules/foobar.ooo_12.1.3/ooo-manifest.jar"; + + longClassPath += ps + appJar; + // Dump an archive with a specified JAR file in -classpath + TestCommon.testDump(longClassPath, TestCommon.list("Hello")); + + // Then try to execute the archive with a different classpath and with -XX:+TraceClassPaths. + // The diagnosis "expecting" app classpath trace should show the entire classpath. + OutputAnalyzer output = TestCommon.execCommon( + "-XX:+TraceClassPaths", + "-cp", appJar, + "Hello"); + output.shouldContain("Unable to use shared archive"); + output.shouldContain("shared class paths mismatch"); + // the "expecting" app classpath from -XX:+TraceClassPaths should not + // be truncated + output.shouldContain(longClassPath); + output.shouldHaveExitValue(1); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/UseAppCDS.java b/test/hotspot/jtreg/runtime/appcds/UseAppCDS.java new file mode 100644 index 00000000000..639c06de59c --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/UseAppCDS.java @@ -0,0 +1,228 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Testing use of UseAppCDS flag + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @build UseAppCDS_Test + * @run main UseAppCDS + */ + +import jdk.test.lib.JDKToolLauncher; +import jdk.test.lib.cds.CDSTestUtils; +import jdk.test.lib.process.OutputAnalyzer; +import jdk.test.lib.process.ProcessTools; + +import java.util.ArrayList; +import java.util.List; +import java.io.*; + +public class UseAppCDS { + + // Class UseAppCDS_Test is loaded by the App loader + + static final String TEST_OUT = "UseAppCDS_Test.main--executed"; + + private static final String TESTJAR = "./test.jar"; + private static final String TESTNAME = "UseAppCDS_Test"; + private static final String TESTCLASS = TESTNAME + ".class"; + + private static final String CLASSES_DIR = System.getProperty("test.classes", "."); + private static final String CLASSLIST_FILE = "./UseAppCDS.classlist"; + private static final String ARCHIVE_FILE = "./shared.jsa"; + private static final String BOOTCLASS = "java.lang.Class"; + + public static void main(String[] args) throws Exception { + + // First create a jar file for the application "test" class + JDKToolLauncher jar = JDKToolLauncher.create("jar") + .addToolArg("-cf") + .addToolArg(TESTJAR) + .addToolArg("-C") + .addToolArg(CLASSES_DIR) + .addToolArg(TESTCLASS); + + ProcessBuilder pb = new ProcessBuilder(jar.getCommand()); + TestCommon.executeAndLog(pb, "jar01").shouldHaveExitValue(0); + + pb = new ProcessBuilder(jar.getCommand()); + TestCommon.executeAndLog(pb, "jar02").shouldHaveExitValue(0); + + // In all tests the BOOTCLASS should be loaded/dumped/used + + // Test 1: No AppCDS - dumping loaded classes excludes the "test" classes + dumpLoadedClasses(false, new String[] { BOOTCLASS }, + new String[] { TESTNAME }); + + // Test 2: AppCDS - dumping loaded classes includes "test" classes + dumpLoadedClasses(true, new String[] { BOOTCLASS, TESTNAME }, + new String[0]); + + // Next tests rely on the classlist we just dumped + + // Test 3: No AppCDS - "test" classes in classlist ignored when dumping + dumpArchive(false, new String[] { BOOTCLASS }, + new String[] { TESTNAME}); + + // Test 4: AppCDS - "test" classes in classlist are dumped + dumpArchive(true, new String[] { BOOTCLASS, TESTNAME }, + new String[0]); + + // Next tests rely on the archive we just dumped + + // Test 5: No AppCDS - Using archive containing "test" classes ignores them + useArchive(false, new String[] { BOOTCLASS }, + new String[] { TESTNAME }); + + // Test 6: AppCDS - Using archive containing "test" classes loads them + useArchive(true, new String[] { BOOTCLASS, TESTNAME }, + new String[0]); + } + + public static List toClassNames(String filename) throws IOException { + ArrayList classes = new ArrayList<>(); + BufferedReader br = new BufferedReader(new InputStreamReader(new FileInputStream(filename))); + for (; ; ) { + String line = br.readLine(); + if (line == null) + break; + classes.add(line.replaceAll("/", ".")); + } + return classes; + } + + static void dumpLoadedClasses(boolean useAppCDS, String[] expectedClasses, + String[] unexpectedClasses) throws Exception { + ProcessBuilder pb = ProcessTools.createJavaProcessBuilder( + true, + "-XX:DumpLoadedClassList=" + CLASSLIST_FILE, + "-cp", + TESTJAR, + useAppCDS ? "-XX:+UseAppCDS" : "-XX:-UseAppCDS", + TESTNAME, + TEST_OUT); + + OutputAnalyzer output = TestCommon.executeAndLog(pb, "dump-loaded-classes") + .shouldHaveExitValue(0).shouldContain(TEST_OUT); + + List dumpedClasses = toClassNames(CLASSLIST_FILE); + + for (String clazz : expectedClasses) { + if (!dumpedClasses.contains(clazz)) { + throw new RuntimeException(clazz + " missing in " + + CLASSLIST_FILE); + } + } + for (String clazz : unexpectedClasses) { + if (dumpedClasses.contains(clazz)) { + throw new RuntimeException("Unexpectedly found " + clazz + + " in " + CLASSLIST_FILE); + } + } + } + + static void dumpArchive(boolean useAppCDS, String[] expectedClasses, + String[] unexpectedClasses) throws Exception { + ProcessBuilder pb = ProcessTools.createJavaProcessBuilder( + true, + useAppCDS ? "-XX:-UnlockDiagnosticVMOptions" : + "-XX:+UnlockDiagnosticVMOptions", + "-cp", + TESTJAR, + useAppCDS ? "-XX:+UseAppCDS" : "-XX:-UseAppCDS", + "-XX:SharedClassListFile=" + CLASSLIST_FILE, + "-XX:SharedArchiveFile=" + ARCHIVE_FILE, + "-Xlog:cds", + "-Xshare:dump"); + + OutputAnalyzer output = TestCommon.executeAndLog(pb, "dump-archive") + .shouldHaveExitValue(0); + + for (String clazz : expectedClasses) { + String failed = "Preload Warning: Cannot find " + clazz; + output.shouldNotContain(failed); + } + for (String clazz : unexpectedClasses) { + String failed = "Preload Warning: Cannot find " + clazz; + output.shouldContain(failed); + } + } + + static void useArchive(boolean useAppCDS, String[] expectedClasses, + String[] unexpectedClasses) throws Exception { + ProcessBuilder pb = ProcessTools.createJavaProcessBuilder( + true, + useAppCDS ? "-XX:-UnlockDiagnosticVMOptions" : + "-XX:+UnlockDiagnosticVMOptions", + "-cp", + TESTJAR, + useAppCDS ? "-XX:+UseAppCDS" : "-XX:-UseAppCDS", + "-XX:SharedArchiveFile=" + ARCHIVE_FILE, + "-verbose:class", + "-Xshare:on", + TESTNAME, + TEST_OUT ); + + OutputAnalyzer output = TestCommon.executeAndLog(pb, "use-archive"); + if (CDSTestUtils.isUnableToMap(output)) + System.out.println("Unable to map: test case skipped"); + else + output.shouldHaveExitValue(0).shouldContain(TEST_OUT); + + // Quote the class name in the regex as it may contain $ + String prefix = ".class,load. "; + String archive_suffix = ".*source: shared objects file.*"; + String jar_suffix = ".*source: .*\\.jar"; + + for (String clazz : expectedClasses) { + String pattern = prefix + clazz + archive_suffix; + try { + output.shouldMatch(pattern); + } catch (Exception e) { + TestCommon.checkCommonExecExceptions(output, e); + } + } + + for (String clazz : unexpectedClasses) { + String pattern = prefix + clazz + archive_suffix; + try { + output.shouldNotMatch(pattern); + } catch (Exception e) { + TestCommon.checkCommonExecExceptions(output, e); + } + pattern = prefix + clazz + jar_suffix; + try { + output.shouldMatch(pattern); + } catch (Exception e) { + TestCommon.checkCommonExecExceptions(output, e); + } + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/UseAppCDS_Test.java b/test/hotspot/jtreg/runtime/appcds/UseAppCDS_Test.java new file mode 100644 index 00000000000..438c614445b --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/UseAppCDS_Test.java @@ -0,0 +1,30 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ +public class UseAppCDS_Test { + // args are from UseAppCDS: + // args[0] = TEST_OUT + public static void main(String[] args) { + System.out.println(args[0]); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/VerifierTest.java b/test/hotspot/jtreg/runtime/appcds/VerifierTest.java new file mode 100644 index 00000000000..ba7f5d1b831 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/VerifierTest.java @@ -0,0 +1,343 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.io.File; +import java.io.FileOutputStream; +import jdk.test.lib.process.OutputAnalyzer; +import java.nio.file.Files; + +import java.util.*; +import jdk.internal.org.objectweb.asm.*; + +/** + * The testsets contained in this class are executed by ./VerifierTest_*.java, so that + * individual testsets can be executed in parallel to shorten the total time required. + */ +public class VerifierTest implements Opcodes { + // Test verification settings for dumping & runtime + static final String VFY_ALL = "-Xverify:all"; + static final String VFY_REMOTE = "-Xverify:remote"; // default + static final String VFY_NONE = "-Xverify:none"; + + static final String ERR = + "ERROR: class VerifierTestC was loaded unexpectedly"; + static final String MAP_FAIL = + "shared archive file was created with less restrictive verification setting"; + static final String VFY_ERR = "java.lang.VerifyError"; + + enum Testset1Part { + A, B + } + + public static void main(String[] args) throws Exception { + String subCaseId = args[0]; + String jarName_verifier_test_tmp = "verifier_test_tmp" + "_" + subCaseId; + String jarName_verifier_test = "verifier_test" + "_" + subCaseId; + String jarName_greet = "greet" + "_" + subCaseId; + String jarName_hi = "hi" + "_" + subCaseId; + + + JarBuilder.build(jarName_verifier_test_tmp, "VerifierTest0", "VerifierTestA", + "VerifierTestB", "VerifierTestC", "VerifierTestD", "VerifierTestE", + "UnverifiableBase", "UnverifiableIntf", "UnverifiableIntfSub"); + JarBuilder.build(jarName_greet, "Greet"); + JarBuilder.build(jarName_hi, "Hi", "Hi$MyClass"); + + File dir = new File(System.getProperty("test.classes", ".")); + File jarSrcFile = new File(dir, jarName_verifier_test_tmp + ".jar"); + File jarFile = new File(dir, jarName_verifier_test + ".jar"); + String jar = jarFile.getPath(); + + if (!jarFile.exists() || jarFile.lastModified() < jarSrcFile.lastModified()) { + createTestJarFile(jarSrcFile, jarFile); + } else { + System.out.println("Already up-to-date: " + jarFile); + } + + String noAppClasses[] = TestCommon.list(""); + String appClasses[] = TestCommon.list("UnverifiableBase", + "UnverifiableIntf", + "UnverifiableIntfSub", + "VerifierTestA", + "VerifierTestB", + "VerifierTestC", + "VerifierTestD", + "VerifierTestE", + "VerifierTest0"); + + + switch (subCaseId) { + case "0": testset_0(jar, noAppClasses, appClasses); return; + case "1A": testset_1(jar, noAppClasses, appClasses, Testset1Part.A); return; + case "1B": testset_1(jar, noAppClasses, appClasses, Testset1Part.B); return; + case "2": testset_2(jarName_greet, jarName_hi); return; + default: + throw new RuntimeException("Unknown option: " + subCaseId); + } + } + + static void testset_0(String jar, String[] noAppClasses, String[] appClasses) throws Exception { + // Dumping should fail if the IgnoreUnverifiableClassesDuringDump + // option is not enabled. + OutputAnalyzer output = TestCommon.dump(jar, appClasses, + "-XX:+UnlockDiagnosticVMOptions", + "-XX:-IgnoreUnverifiableClassesDuringDump"); + output.shouldContain("Please remove the unverifiable classes"); + output.shouldHaveExitValue(1); + + // By default, bad classes should be ignored during dumping. + TestCommon.testDump(jar, appClasses); + } + + static void testset_1(String jar, String[] noAppClasses, String[] appClasses, Testset1Part part) + throws Exception + { + String config[][] = { + // {dump_list, dumptime_verification_setting, + // runtime_verification_setting, runtime_output}, + + // Dump app/ext with -Xverify:remote + {"app", VFY_REMOTE, VFY_REMOTE, VFY_ERR}, + {"app", VFY_REMOTE, VFY_ALL, MAP_FAIL}, + {"app", VFY_REMOTE, VFY_NONE, ERR }, + // Dump app/ext with -Xverify:all + {"app", VFY_ALL, VFY_REMOTE, VFY_ERR }, + {"app", VFY_ALL, VFY_ALL, VFY_ERR }, + {"app", VFY_ALL, VFY_NONE, ERR }, + // Dump app/ext with -Xverify:none + {"app", VFY_NONE, VFY_REMOTE, MAP_FAIL}, + {"app", VFY_NONE, VFY_ALL, MAP_FAIL}, + {"app", VFY_NONE, VFY_NONE, ERR }, + // Dump sys only with -Xverify:remote + {"noApp", VFY_REMOTE, VFY_REMOTE, VFY_ERR}, + {"noApp", VFY_REMOTE, VFY_ALL, VFY_ERR}, + {"noApp", VFY_REMOTE, VFY_NONE, ERR}, + // Dump sys only with -Xverify:all + {"noApp", VFY_ALL, VFY_REMOTE, VFY_ERR}, + {"noApp", VFY_ALL, VFY_ALL, VFY_ERR}, + {"noApp", VFY_ALL, VFY_NONE, ERR}, + // Dump sys only with -Xverify:none + {"noApp", VFY_NONE, VFY_REMOTE, VFY_ERR}, + {"noApp", VFY_NONE, VFY_ALL, VFY_ERR}, + {"noApp", VFY_NONE, VFY_NONE, ERR}, + }; + + int loop_start, loop_stop; + + // Further break down testset_1 into two parts (to be invoked from VerifierTest_1A.java + // and VerifierTest_1B.java) to improve parallel test execution time. + switch (part) { + case A: + loop_start = 0; + loop_stop = 9; + break; + case B: + default: + assert part == Testset1Part.B; + loop_start = 9; + loop_stop = config.length; + break; + } + + String prev_dump_setting = ""; + for (int i = loop_start; i < loop_stop; i ++) { + String dump_list[] = config[i][0].equals("app") ? appClasses : + noAppClasses; + String dump_setting = config[i][1]; + String runtime_setting = config[i][2]; + String runtime_output = config[i][3]; + System.out.println("Test case [" + i + "]: dumping " + config[i][0] + + " with " + dump_setting + + ", run with " + runtime_setting); + if (!dump_setting.equals(prev_dump_setting)) { + OutputAnalyzer dumpOutput = TestCommon.dump( + jar, dump_list, dump_setting, + // FIXME: the following options are for working around a GC + // issue - assert failure when dumping archive with the -Xverify:all + "-Xms256m", + "-Xmx256m"); + } + OutputAnalyzer runtimeOutput = TestCommon.execCommon( + "-cp", jar, + runtime_setting, + "VerifierTest0"); + try { + runtimeOutput.shouldContain(runtime_output); + } catch (RuntimeException re) { + // Check if the failure is due to archive mapping failure. + // If not, a RuntimeException will be thrown. + runtimeOutput.shouldContain("Unable to use shared archive"); + } + prev_dump_setting = dump_setting; + } + } + + static void testset_2(String jarName_greet, String jarName_hi) throws Exception { + String appClasses[]; + String jar; + + // The following section is for testing the scenarios where + // the classes are verifiable during dump time. + appClasses = TestCommon.list("Hi", + "Greet", + "Hi$MyClass"); + jar = TestCommon.getTestJar(jarName_hi + ".jar") + File.pathSeparator + + TestCommon.getTestJar(jarName_greet + ".jar"); + final String PASS_RESULT = "Hi, how are you?"; + String config2[][] = { + // {dump_list, dumptime_verification_setting, + // runtime_verification_setting, runtime_output}, + + // Dump app/ext with -Xverify:remote + {"app", VFY_REMOTE, VFY_REMOTE, PASS_RESULT}, + {"app", VFY_REMOTE, VFY_ALL, MAP_FAIL}, + {"app", VFY_REMOTE, VFY_NONE, PASS_RESULT }, + // Dump app/ext with -Xverify:all + {"app", VFY_ALL, VFY_REMOTE, PASS_RESULT }, + {"app", VFY_ALL, VFY_ALL, PASS_RESULT }, + {"app", VFY_ALL, VFY_NONE, PASS_RESULT }, + // Dump app/ext with -Xverify:none + {"app", VFY_NONE, VFY_REMOTE, MAP_FAIL}, + {"app", VFY_NONE, VFY_ALL, MAP_FAIL}, + {"app", VFY_NONE, VFY_NONE, PASS_RESULT }, + }; + for (int i = 0; i < config2.length; i ++) { + // config2[i][0] is always set to "app" in this test + String dump_setting = config2[i][1]; + String runtime_setting = config2[i][2]; + String runtime_output = config2[i][3]; + System.out.println("Test case [" + i + "]: dumping " + config2[i][0] + + " with " + dump_setting + + ", run with " + runtime_setting); + OutputAnalyzer dumpOutput = TestCommon.dump( + jar, appClasses, dump_setting, + "-XX:+UnlockDiagnosticVMOptions", + // FIXME: the following options are for working around a GC + // issue - assert failure when dumping archive with the -Xverify:all + "-Xms256m", + "-Xmx256m"); + OutputAnalyzer runtimeOutput = TestCommon.execCommon( + "-cp", jar, + runtime_setting, + "Hi"); + try { + runtimeOutput.shouldContain(runtime_output); + } catch (RuntimeException re) { + // Check if the failure is due to archive mapping failure. + // If not, a RuntimeException will be thrown. + runtimeOutput.shouldContain("Unable to use shared archive"); + } + } + + } + + static void createTestJarFile(File jarSrcFile, File jarFile) throws Exception { + jarFile.delete(); + Files.copy(jarSrcFile.toPath(), jarFile.toPath()); + + File dir = new File(System.getProperty("test.classes", ".")); + File outdir = new File(dir, "verifier_test_classes"); + outdir.mkdir(); + + writeClassFile(new File(outdir, "UnverifiableBase.class"), makeUnverifiableBase()); + writeClassFile(new File(outdir, "UnverifiableIntf.class"), makeUnverifiableIntf()); + + JarBuilder.update(jarFile.getPath(), outdir.getPath()); + } + + static void writeClassFile(File file, byte bytecodes[]) throws Exception { + try (FileOutputStream fos = new FileOutputStream(file)) { + fos.write(bytecodes); + } + } + + // This was obtained using JDK8: java jdk.internal.org.objectweb.asm.util.ASMifier tmpclasses/UnverifiableBase.class + static byte[] makeUnverifiableBase() throws Exception { + ClassWriter cw = new ClassWriter(0); + FieldVisitor fv; + MethodVisitor mv; + AnnotationVisitor av0; + + cw.visit(V1_6, ACC_SUPER, "UnverifiableBase", null, "java/lang/Object", null); + { + fv = cw.visitField(ACC_FINAL + ACC_STATIC, "x", "LVerifierTest;", null, null); + fv.visitEnd(); + } + { + mv = cw.visitMethod(0, "", "()V", null, null); + mv.visitCode(); + mv.visitVarInsn(ALOAD, 0); + mv.visitMethodInsn(INVOKESPECIAL, "java/lang/Object", "", "()V", false); + mv.visitInsn(RETURN); + mv.visitMaxs(1, 1); + mv.visitEnd(); + } + { + mv = cw.visitMethod(ACC_STATIC, "", "()V", null, null); + mv.visitCode(); + //WAS mv.visitTypeInsn(NEW, "VerifierTest"); + mv.visitTypeInsn(NEW, "java/lang/Object"); + mv.visitInsn(DUP); + mv.visitMethodInsn(INVOKESPECIAL, "VerifierTest0", "", "()V", false); + mv.visitFieldInsn(PUTSTATIC, "UnverifiableBase", "x", "LVerifierTest;"); + mv.visitInsn(RETURN); + mv.visitMaxs(2, 0); + mv.visitEnd(); + } + cw.visitEnd(); + + return cw.toByteArray(); + } + + // This was obtained using JDK8: java jdk.internal.org.objectweb.asm.util.ASMifier tmpclasses/UnverifiableIntf.class + static byte[] makeUnverifiableIntf() throws Exception { + ClassWriter cw = new ClassWriter(0); + FieldVisitor fv; + MethodVisitor mv; + AnnotationVisitor av0; + + cw.visit(V1_6, ACC_ABSTRACT + ACC_INTERFACE, "UnverifiableIntf", null, "java/lang/Object", null); + + { + fv = cw.visitField(ACC_PUBLIC + ACC_FINAL + ACC_STATIC, "x", "LVerifierTest0;", null, null); + fv.visitEnd(); + } + { + mv = cw.visitMethod(ACC_STATIC, "", "()V", null, null); + mv.visitCode(); + //WAS mv.visitTypeInsn(NEW, "VerifierTest"); + mv.visitTypeInsn(NEW, "java/lang/Object"); + mv.visitInsn(DUP); + mv.visitMethodInsn(INVOKESPECIAL, "VerifierTest0", "", "()V", false); + mv.visitFieldInsn(PUTSTATIC, "UnverifiableIntf", "x", "LVerifierTest0;"); + mv.visitInsn(RETURN); + mv.visitMaxs(2, 0); + mv.visitEnd(); + } + cw.visitEnd(); + + return cw.toByteArray(); + } + +} diff --git a/test/hotspot/jtreg/runtime/appcds/VerifierTest_0.java b/test/hotspot/jtreg/runtime/appcds/VerifierTest_0.java new file mode 100644 index 00000000000..6ed2f6d35d5 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/VerifierTest_0.java @@ -0,0 +1,38 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Unverfiable app classes should not be archived. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * @modules jdk.jartool/sun.tools.jar + * java.base/jdk.internal.org.objectweb.asm + * @compile test-classes/Greet.java + * @compile test-classes/Hi.java + * @compile test-classes/VerifierTest0.java + * @run main/othervm/timeout=3600 VerifierTest 0 + */ diff --git a/test/hotspot/jtreg/runtime/appcds/VerifierTest_1A.java b/test/hotspot/jtreg/runtime/appcds/VerifierTest_1A.java new file mode 100644 index 00000000000..8a5430e2263 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/VerifierTest_1A.java @@ -0,0 +1,38 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Unverfiable app classes should not be archived. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * @modules jdk.jartool/sun.tools.jar + * java.base/jdk.internal.org.objectweb.asm + * @compile test-classes/Greet.java + * @compile test-classes/Hi.java + * @compile test-classes/VerifierTest0.java + * @run main/othervm/timeout=3600 VerifierTest 1A + */ diff --git a/test/hotspot/jtreg/runtime/appcds/VerifierTest_1B.java b/test/hotspot/jtreg/runtime/appcds/VerifierTest_1B.java new file mode 100644 index 00000000000..7a721d13ba8 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/VerifierTest_1B.java @@ -0,0 +1,38 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Unverfiable app classes should not be archived. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * @modules jdk.jartool/sun.tools.jar + * java.base/jdk.internal.org.objectweb.asm + * @compile test-classes/Greet.java + * @compile test-classes/Hi.java + * @compile test-classes/VerifierTest0.java + * @run main/othervm/timeout=3600 VerifierTest 1B + */ diff --git a/test/hotspot/jtreg/runtime/appcds/VerifierTest_2.java b/test/hotspot/jtreg/runtime/appcds/VerifierTest_2.java new file mode 100644 index 00000000000..c7bbe8793f7 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/VerifierTest_2.java @@ -0,0 +1,38 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Unverfiable app classes should not be archived. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * @modules jdk.jartool/sun.tools.jar + * java.base/jdk.internal.org.objectweb.asm + * @compile test-classes/Greet.java + * @compile test-classes/Hi.java + * @compile test-classes/VerifierTest0.java + * @run main/othervm/timeout=3600 VerifierTest 2 + */ diff --git a/test/hotspot/jtreg/runtime/appcds/WideIloadTest.java b/test/hotspot/jtreg/runtime/appcds/WideIloadTest.java new file mode 100644 index 00000000000..9323924449d --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/WideIloadTest.java @@ -0,0 +1,50 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/** + * @test + * @summary Test 'iload_w' bytecode in shared class + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Iloadw.jasm + * @compile test-classes/IloadwMain.java + * @run main WideIloadTest + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class WideIloadTest { + public static void main(String args[]) throws Exception { + JarBuilder.build("iload_w", "Iloadw", "IloadwMain"); + String appJar = TestCommon.getTestJar("iload_w.jar"); + OutputAnalyzer dumpOutput = TestCommon.dump(appJar, TestCommon.list( + "Iloadw", "IloadwMain")); + TestCommon.checkDump(dumpOutput); + OutputAnalyzer execOutput = TestCommon.exec(appJar, "IloadwMain"); + TestCommon.checkExec(execOutput, "Passed"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/WrongClasspath.java b/test/hotspot/jtreg/runtime/appcds/WrongClasspath.java new file mode 100644 index 00000000000..d3069c33cd9 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/WrongClasspath.java @@ -0,0 +1,56 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary classpath mismatch between dump time and execution time + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java + * @run main WrongClasspath + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class WrongClasspath { + + public static void main(String[] args) throws Exception { + String appJar = JarBuilder.getOrCreateHelloJar(); + + // Dump an archive with a specified JAR file in -classpath + TestCommon.testDump(appJar, TestCommon.list("Hello")); + + // Then try to execute the archive without -classpath -- it should fail + OutputAnalyzer output = TestCommon.execCommon( + /* "-cp", appJar, */ // <- uncomment this and the execution should succeed + "Hello"); + output.shouldContain("Unable to use shared archive"); + output.shouldContain("shared class paths mismatch"); + output.shouldHaveExitValue(1); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/XShareAutoWithChangedJar.java b/test/hotspot/jtreg/runtime/appcds/XShareAutoWithChangedJar.java new file mode 100644 index 00000000000..d3c5c8ef50c --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/XShareAutoWithChangedJar.java @@ -0,0 +1,55 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Test -Xshare:auto for AppCDS + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java + * @run main XShareAutoWithChangedJar + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class XShareAutoWithChangedJar { + public static void main(String[] args) throws Exception { + String appJar = JarBuilder.build("XShareAutoWithChangedJar", "Hello"); + + // 1. dump + OutputAnalyzer output = TestCommon.dump(appJar, TestCommon.list("Hello")); + TestCommon.checkDump(output); + + // 2. change the jar + JarBuilder.build("XShareAutoWithChangedJar", "Hello"); + + // 3. exec + output = TestCommon.execAuto("-cp", appJar, "Hello"); + output.shouldContain("Hello World"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/cacheObject/CheckCachedResolvedReferences.java b/test/hotspot/jtreg/runtime/appcds/cacheObject/CheckCachedResolvedReferences.java new file mode 100644 index 00000000000..73df2eaf816 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/CheckCachedResolvedReferences.java @@ -0,0 +1,69 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Test resolved_references + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires (sun.arch.data.model == "64") + * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris") + * @requires (vm.gc=="null") + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @build sun.hotspot.WhiteBox + * @compile CheckCachedResolvedReferencesApp.java + * @compile ../test-classes/Hello.java + * @run main ClassFileInstaller -jar app.jar CheckCachedResolvedReferencesApp + * @run main ClassFileInstaller -jar hello.jar Hello + * @run main ClassFileInstaller -jar WhiteBox.jar sun.hotspot.WhiteBox + * @run main CheckCachedResolvedReferences + */ + +import jdk.test.lib.process.OutputAnalyzer; +import sun.hotspot.WhiteBox; + +public class CheckCachedResolvedReferences { + public static void main(String[] args) throws Exception { + String wbJar = ClassFileInstaller.getJarPath("WhiteBox.jar"); + String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar; + String appJar = ClassFileInstaller.getJarPath("app.jar"); + String helloJarPath = ClassFileInstaller.getJarPath("hello.jar"); + + String classlist[] = new String[] { + "CheckCachedResolvedReferencesApp", + "java/lang/Object id: 1", + "Hello id: 2 super: 1 source: " + helloJarPath + }; + + TestCommon.testDump(appJar, classlist, use_whitebox_jar); + OutputAnalyzer output = TestCommon.exec(appJar, use_whitebox_jar, + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", + "CheckCachedResolvedReferencesApp", + helloJarPath); + TestCommon.checkExec(output); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/cacheObject/CheckCachedResolvedReferencesApp.java b/test/hotspot/jtreg/runtime/appcds/cacheObject/CheckCachedResolvedReferencesApp.java new file mode 100644 index 00000000000..0db69dd3391 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/CheckCachedResolvedReferencesApp.java @@ -0,0 +1,77 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.io.File; +import java.net.URL; +import java.net.URLClassLoader; +import sun.hotspot.WhiteBox; + +public class CheckCachedResolvedReferencesApp { + public static void main(String args[]) throws Exception { + String path = args[0]; + URL url = new File(path).toURI().toURL(); + URL[] urls = new URL[] {url}; + + URLClassLoader loader = new URLClassLoader(urls); + Class hello = loader.loadClass("Hello"); + System.out.println("Loaded " + hello + " from " + url + " using loader " + loader); + + WhiteBox wb = WhiteBox.getWhiteBox(); + + if (!wb.areOpenArchiveHeapObjectsMapped()) { + System.out.println("Archived open_archive_heap objects are not mapped."); + System.out.println("This may happen during normal operation. Test Skipped."); + return; + } + + // CheckCachedResolvedReferencesApp is shared class and loaded by the + // AppClassLoader. It should have cached resolved_references. + if (wb.isSharedClass(CheckCachedResolvedReferencesApp.class)) { + Object refs1 = wb.getResolvedReferences(CheckCachedResolvedReferencesApp.class); + if (refs1 != null && wb.isShared(refs1)) { + System.out.println( + "resolved references from CheckCachedResolvedReferencesApp is cached"); + } else { + throw new RuntimeException( + "FAILED. CheckCachedResolvedReferencesApp has no cached resolved references"); + } + } + + // Hello is shared class and loaded by the 'loader' defined in current app. + // It should not have cached resolved_references. + if (wb.isSharedClass(hello)) { + Object refs2 = wb.getResolvedReferences(hello); + if (refs2 != null) { + if (!wb.isShared(refs2)) { + System.out.println("resolved references from hello is not cached"); + } else { + throw new RuntimeException( + "FAILED. Hello has unexpected cached resolved references"); + } + } else { + throw new RuntimeException("FAILED. Hello has no resolved references"); + } + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/cacheObject/DumpTimeVerifyFailure.config.txt b/test/hotspot/jtreg/runtime/appcds/cacheObject/DumpTimeVerifyFailure.config.txt new file mode 100644 index 00000000000..fb6912f2c3c --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/DumpTimeVerifyFailure.config.txt @@ -0,0 +1,3 @@ +VERSION: 1.0 +@SECTION: String +26: shared_string_from_MyInner diff --git a/test/hotspot/jtreg/runtime/appcds/cacheObject/DumpTimeVerifyFailure.java b/test/hotspot/jtreg/runtime/appcds/cacheObject/DumpTimeVerifyFailure.java new file mode 100644 index 00000000000..12be0931edf --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/DumpTimeVerifyFailure.java @@ -0,0 +1,63 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Dump time should not crash if any class with shared strings fails verification due to missing dependencies. + * @bug 8186789 + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @requires (vm.gc=="null") + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @compile MyOuter.java MyException.java + * @run main DumpTimeVerifyFailure + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class DumpTimeVerifyFailure { + public static void main(String[] args) throws Exception { + // App classes (see MyOuter.java): + // MyOuter + // MyInnder$MyOuter extends MyOuter + // MyException + // + // MyOuter$MyInner.test() throws MyException. + // The missingMyException.jar file only includes MyOuter and + // MyOuter$MyInner classes, but not the MyException class. + // At dump time, MyOuter and MyOuter$MyInner classes fail + // verification due to missing MyException class. + String[] ARCHIVE_CLASSES = {"MyOuter", "MyOuter$MyInner"}; + String appJar = JarBuilder.build("missingMyException", ARCHIVE_CLASSES); + + OutputAnalyzer dumpOutput = TestCommon.dump( + appJar, ARCHIVE_CLASSES, + "-Xlog:verification", + "-XX:SharedArchiveConfigFile=" + TestCommon.getSourceFile("DumpTimeVerifyFailure.config.txt")); + TestCommon.checkDump(dumpOutput, "Loading classes to share"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/cacheObject/GCStress.config.txt b/test/hotspot/jtreg/runtime/appcds/cacheObject/GCStress.config.txt new file mode 100644 index 00000000000..af3e33bb977 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/GCStress.config.txt @@ -0,0 +1,3 @@ +VERSION: 1.0 +@SECTION: String +25: GCStressApp_shared_string diff --git a/test/hotspot/jtreg/runtime/appcds/cacheObject/GCStressApp.java b/test/hotspot/jtreg/runtime/appcds/cacheObject/GCStressApp.java new file mode 100644 index 00000000000..636da040d6b --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/GCStressApp.java @@ -0,0 +1,93 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.io.*; +import java.util.*; +import sun.hotspot.WhiteBox; + +// All strings in archived classes are shared +public class GCStressApp { + static WhiteBox wb = WhiteBox.getWhiteBox(); + static int[] arr; + + static String get_shared_string() { + String shared_str = "GCStressApp_shared_string"; + return shared_str; + } + + static String get_shared_string1() { + String shared_str1 = "GCStressApp_shared_string1"; + return shared_str1; + } + + static void allocAlot() { + try { + Random random = new Random(); + for (int i = 0; i < 1024 * 1024; i++) { + int len = random.nextInt(10000); + arr = new int[len]; + } + } catch (java.lang.OutOfMemoryError e) { } + } + + static void runGC() { + wb.fullGC(); + } + + public static void main(String args[]) throws Exception { + if (!wb.isSharedClass(GCStressApp.class)) { + System.out.println("GCStressApp is not shared. Possibly there was a mapping failure."); + return; + } + + if (wb.areSharedStringsIgnored()) { + System.out.println("Shared strings are ignored."); + return; + } + + Object refs = wb.getResolvedReferences(GCStressApp.class); + if (wb.isShared(refs)) { + String shared_str = get_shared_string(); + String shared_str1 = get_shared_string1(); + + if (!wb.isShared(shared_str)) { + throw new RuntimeException("FAILED. GCStressApp_shared_string is not shared"); + } + + if (!wb.isShared(shared_str1)) { + throw new RuntimeException("FAILED. GCStressApp_shared_string1 is not shared"); + } + + allocAlot(); + runGC(); + runGC(); + runGC(); + + System.out.println("Passed"); + } else { + System.out.println( + "No cached resolved references. Open archive heap data is not used."); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/cacheObject/GCStressTest.java b/test/hotspot/jtreg/runtime/appcds/cacheObject/GCStressTest.java new file mode 100644 index 00000000000..591de9b3e67 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/GCStressTest.java @@ -0,0 +1,61 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @requires (vm.gc=="null") + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @build sun.hotspot.WhiteBox + * @compile GCStressApp.java + * @run main ClassFileInstaller -jar gcstress.jar GCStressApp + * @run main ClassFileInstaller -jar WhiteBox.jar sun.hotspot.WhiteBox + * @run main GCStressTest + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class GCStressTest { + public static void main(String[] args) throws Exception { + String wbJar = ClassFileInstaller.getJarPath("WhiteBox.jar"); + String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar; + String appJar = ClassFileInstaller.getJarPath("gcstress.jar"); + String appClasses[] = TestCommon.list("GCStressApp"); + + OutputAnalyzer output = TestCommon.dump(appJar, appClasses, + use_whitebox_jar, + "-Xms20M", "-Xmx20M"); + output = TestCommon.exec(appJar, use_whitebox_jar, + "-Xlog:cds=info", + "-Xms20M", "-Xmx20M", + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI","GCStressApp"); + TestCommon.checkExec(output); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/cacheObject/InstrumentationAgent.mf b/test/hotspot/jtreg/runtime/appcds/cacheObject/InstrumentationAgent.mf new file mode 100644 index 00000000000..58dcf797de6 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/InstrumentationAgent.mf @@ -0,0 +1,5 @@ +Manifest-Version: 1.0 +Premain-Class: InstrumentationRegisterClassFileTransformer +Agent-Class: InstrumentationRegisterClassFileTransformer +Can-Retransform-Classes: true +Can-Redefine-Classes: true diff --git a/src/hotspot/share/classfile/vmSymbols_ext.hpp b/test/hotspot/jtreg/runtime/appcds/cacheObject/MyException.java similarity index 79% rename from src/hotspot/share/classfile/vmSymbols_ext.hpp rename to test/hotspot/jtreg/runtime/appcds/cacheObject/MyException.java index 4b68d8f234b..39a464b4f00 100644 --- a/src/hotspot/share/classfile/vmSymbols_ext.hpp +++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/MyException.java @@ -1,5 +1,5 @@ /* - * Copyright (c) 2015, Oracle and/or its affiliates. All rights reserved. + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. * * This code is free software; you can redistribute it and/or modify it @@ -21,11 +21,8 @@ * questions. * */ - -#ifndef SHARE_VM_CLASSFILE_VMSYMBOLS_EXT_HPP -#define SHARE_VM_CLASSFILE_VMSYMBOLS_EXT_HPP - -#define VM_SYMBOLS_DO_EXT(template, do_alias) - -#endif // SHARE_VM_CLASSFILE_VMSYMBOLS_EXT_HPP - +public class MyException extends Exception { + public MyException(String msg) { + super(msg); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/cacheObject/MyOuter.java b/test/hotspot/jtreg/runtime/appcds/cacheObject/MyOuter.java new file mode 100644 index 00000000000..8773772ac68 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/MyOuter.java @@ -0,0 +1,43 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ +public class MyOuter { + public void exp() throws MyException { + throw new MyException("MyOuter exception"); + } + + public void test() throws Exception { + System.out.println("MyOuter"); + try { + exp(); + } catch (MyException e) { + } + } + + public static final class MyInner extends MyOuter { + static String myString = "shared_string_from_MyInner"; + public void test() { + System.out.println("MyInner"); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/cacheObject/OpenArchiveRegion.java b/test/hotspot/jtreg/runtime/appcds/cacheObject/OpenArchiveRegion.java new file mode 100644 index 00000000000..df1b348913f --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/OpenArchiveRegion.java @@ -0,0 +1,63 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Test open archive heap regions + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @requires (vm.gc=="null") + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @compile ../test-classes/Hello.java + * @run main OpenArchiveRegion + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class OpenArchiveRegion { + public static void main(String[] args) throws Exception { + JarBuilder.getOrCreateHelloJar(); + String appJar = TestCommon.getTestJar("hello.jar"); + String appClasses[] = TestCommon.list("Hello"); + + // Dump with open archive heap region, requires G1 GC + OutputAnalyzer output = TestCommon.dump(appJar, appClasses); + TestCommon.checkDump(output, "oa0 space:"); + output.shouldNotContain("oa0 space: 0 ["); + output = TestCommon.exec(appJar, "Hello"); + TestCommon.checkExec(output, "Hello World"); + output = TestCommon.exec(appJar, "-XX:+UseSerialGC", "Hello"); + TestCommon.checkExec(output, "Hello World"); + + // Dump with open archive heap region disabled when G1 GC is not in use + output = TestCommon.dump(appJar, appClasses, "-XX:+UseParallelGC"); + TestCommon.checkDump(output); + output.shouldNotContain("oa0 space:"); + output = TestCommon.exec(appJar, "Hello"); + TestCommon.checkExec(output, "Hello World"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/cacheObject/RangeNotWithinHeap.java b/test/hotspot/jtreg/runtime/appcds/cacheObject/RangeNotWithinHeap.java new file mode 100644 index 00000000000..13242f72f0b --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/RangeNotWithinHeap.java @@ -0,0 +1,72 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Shared classes can still be used when archived heap regions cannot be + * mapped due to out of range, and -Xshare:on should not fail. Test on + * linux 64-bit only since the HeapBaseMinAddress value is platform specific. + * The value used in the test may cause different behavior on other platforms. + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires (os.family == "linux") & (os.arch == "amd64") & (sun.arch.data.model == "64") + * @requires (vm.gc=="null") + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @compile ../test-classes/Hello.java + * @run main RangeNotWithinHeap + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class RangeNotWithinHeap { + public static void main(String[] args) throws Exception { + JarBuilder.getOrCreateHelloJar(); + String appJar = TestCommon.getTestJar("hello.jar"); + String appClasses[] = TestCommon.list("Hello"); + + OutputAnalyzer output = TestCommon.dump(appJar, appClasses, + "-XX:HeapBaseMinAddress=0x600000000", "-Xmx6G", "-Xlog:gc+heap=trace"); + TestCommon.checkDump(output, "oa0 space:"); + + // Force archive region out of runtime java heap + output = TestCommon.exec(appJar, "Hello"); + TestCommon.checkExec(output, "Hello World"); + output = TestCommon.exec(appJar, + "-XX:HeapBaseMinAddress=0x600000000", "-Xmx2G", "-Xlog:gc+heap=trace,cds", "Hello"); + TestCommon.checkExec(output, "Hello World"); + try { + output.shouldContain( + "UseSharedSpaces: Unable to allocate region, range is not within java heap."); + } catch (Exception e) { + // In rare case the heap data is not used. + if (output.getOutput().contains("Cached heap data from the CDS archive is being ignored")) { + return; + } + // Check for common shared class data mapping failures. + TestCommon.checkCommonExecExceptions(output, e); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/cacheObject/RedefineClassApp.java b/test/hotspot/jtreg/runtime/appcds/cacheObject/RedefineClassApp.java new file mode 100644 index 00000000000..fa482e70a5e --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/RedefineClassApp.java @@ -0,0 +1,149 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.lang.instrument.ClassDefinition; +import java.lang.instrument.Instrumentation; +import java.lang.instrument.UnmodifiableClassException; +import java.net.URL; +import java.net.URLClassLoader; +import java.io.File; +import java.security.CodeSigner; +import java.security.CodeSource; +import java.security.ProtectionDomain; +import sun.hotspot.WhiteBox; + +public class RedefineClassApp { + static WhiteBox wb = WhiteBox.getWhiteBox(); + + public static interface Intf { // Loaded from Boot class loader (-Xbootclasspath/a). + public String get(); + } + public static class Bar implements Intf { // Loaded from Boot class loader. + public String get() { + return "buzz"; + } + } + public static class Foo implements Intf { // Loaded from AppClassLoader + public String get() { + return "buzz"; + } + } + + static int numTests = 0; + static int failed = 0; + static Instrumentation instrumentation; + + public static void main(String args[]) throws Throwable { + if (wb.areSharedStringsIgnored()) { + System.out.println("Shared strings are ignored."); + return; + } + + File bootJar = new File(args[0]); + File appJar = new File(args[1]); + + instrumentation = InstrumentationRegisterClassFileTransformer.getInstrumentation(); + System.out.println("INFO: instrumentation = " + instrumentation); + + testBootstrapCDS("Bootstrap Loader", bootJar); + testAppCDSv1("Application Loader", appJar); + + if (failed > 0) { + throw new RuntimeException("FINAL RESULT: " + failed + " out of " + numTests + " test case(s) have failed"); + } else { + System.out.println("FINAL RESULT: All " + numTests + " test case(s) have passed!"); + } + + // Full GC. The cached objects in adjustable archive heap regions are + // scanned. The archive regions are verified. No error should be + // reported. + wb.fullGC(); + } + + static void testBootstrapCDS(String group, File jar) throws Throwable { + doTest(group, new Bar(), jar); + } + + static void testAppCDSv1(String group, File jar) throws Throwable { + doTest(group, new Foo(), jar); + } + + static void doTest(String group, Intf object, File jar) throws Throwable { + numTests ++; + + Class klass = object.getClass(); + System.out.println(); + System.out.println("++++++++++++++++++++++++++"); + System.out.println("Test group: " + group); + System.out.println("Testing with classloader = " + klass.getClassLoader()); + System.out.println("Testing with class = " + klass); + System.out.println("Test is shared = " + wb.isSharedClass(klass)); + System.out.println("++++++++++++++++++++++++++"); + + // Call get() before redefine. All strings in archived classes are shared. + String res = object.get(); + System.out.println("get() returns " + res); + if (res.equals("buzz") && wb.isShared(res)) { + System.out.println("get() returns " + res + ", string is shared"); + } else { + if (!res.equals("buzz")) { + System.out.println("FAILED. buzz is expected but got " + res); + } else { + System.out.println("FAILED. " + res + " is not shared"); + } + failed ++; + return; + } + res = null; // release the local reference to the string + + // Run GC + System.gc(); + System.gc(); + System.gc(); + + // Redefine the shared class + byte[] buff = Util.getClassFileFromJar(jar, klass.getName()); + Util.replace(buff, "buzz", "huzz"); + String f = "(failed)"; + try { + instrumentation.redefineClasses(new ClassDefinition(klass, buff)); + f = object.get(); + } catch (UnmodifiableClassException|UnsupportedOperationException e) { + e.printStackTrace(); + } + if (f.equals("huzz")) { + System.out.println("PASSED: object.get() after redefinition returns " + f); + } else { + System.out.println("FAILED: object.get() after redefinition returns " + f); + failed ++; + } + + // Run GC. Should not crash. + System.gc(); + System.gc(); + System.gc(); + + System.out.println("++++++++++++++++++++++++++++++++++++++++++++++++ (done)\n\n"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/cacheObject/RedefineClassTest.java b/test/hotspot/jtreg/runtime/appcds/cacheObject/RedefineClassTest.java new file mode 100644 index 00000000000..bfcd82f5742 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/RedefineClassTest.java @@ -0,0 +1,105 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Redefine shared class. GC should not cause crash with cached resolved_references. + * @library /test/lib /test/hotspot/jtreg/runtime/appcds /test/hotspot/jtreg/runtime/appcds/test-classes /test/hotspot/jtreg/runtime/appcds/jvmti + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.gc.G1 + * @requires vm.flavor != "minimal" + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * java.management + * @build sun.hotspot.WhiteBox + * RedefineClassApp + * InstrumentationClassFileTransformer + * InstrumentationRegisterClassFileTransformer + * @run main/othervm RedefineClassTest + */ + +import com.sun.tools.attach.VirtualMachine; +import com.sun.tools.attach.VirtualMachineDescriptor; +import java.io.File; +import java.io.FileOutputStream; +import java.util.List; +import jdk.test.lib.Asserts; +import jdk.test.lib.cds.CDSOptions; +import jdk.test.lib.process.OutputAnalyzer; +import jdk.test.lib.process.ProcessTools; + +public class RedefineClassTest { + public static String bootClasses[] = { + "RedefineClassApp$Intf", + "RedefineClassApp$Bar", + "sun.hotspot.WhiteBox", + }; + public static String appClasses[] = { + "RedefineClassApp", + "RedefineClassApp$Foo", + }; + public static String sharedClasses[] = TestCommon.concat(bootClasses, appClasses); + + public static String agentClasses[] = { + "InstrumentationClassFileTransformer", + "InstrumentationRegisterClassFileTransformer", + "Util", + }; + + public static void main(String[] args) throws Throwable { + runTest(); + } + + public static void runTest() throws Throwable { + String bootJar = + ClassFileInstaller.writeJar("RedefineClassBoot.jar", bootClasses); + String appJar = + ClassFileInstaller.writeJar("RedefineClassApp.jar", appClasses); + String agentJar = + ClassFileInstaller.writeJar("InstrumentationAgent.jar", + ClassFileInstaller.Manifest.fromSourceFile("InstrumentationAgent.mf"), + agentClasses); + + String bootCP = "-Xbootclasspath/a:" + bootJar; + + String agentCmdArg; + agentCmdArg = "-javaagent:" + agentJar; + + TestCommon.testDump(appJar, sharedClasses, bootCP, "-Xlog:gc+region=trace"); + + OutputAnalyzer out = TestCommon.execAuto("-cp", appJar, + bootCP, + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", + "-Xlog:gc+region=trace,cds=info", + agentCmdArg, + "RedefineClassApp", bootJar, appJar); + out.reportDiagnosticSummary(); + + CDSOptions opts = (new CDSOptions()).setXShareMode("auto"); + TestCommon.checkExec(out, opts); + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatA.java b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatA.java new file mode 100644 index 00000000000..b90e75d57d8 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatA.java @@ -0,0 +1,138 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Tests the format checking of class list format. + * + * (NOTE: AppCDS does not support uncompressed oops) + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires (sun.arch.data.model == "64") + * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris") + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java test-classes/CustomLoadee.java test-classes/CustomLoadee2.java + * test-classes/CustomInterface2_ia.java test-classes/CustomInterface2_ib.java + * @run main ClassListFormatA + */ + +public class ClassListFormatA extends ClassListFormatBase { + static { + // Uncomment the following line to run only one of the test cases + // ClassListFormatBase.RUN_ONLY_TEST = "TESTCASE A1"; + } + + public static void main(String[] args) throws Throwable { + String appJar = JarBuilder.getOrCreateHelloJar(); + String customJarPath = JarBuilder.build("ClassListFormatA", "CustomLoadee", + "CustomLoadee2", "CustomInterface2_ia", "CustomInterface2_ib"); + //---------------------------------------------------------------------- + // TESTGROUP A: general bad input + //---------------------------------------------------------------------- + dumpShouldFail( + "TESTCASE A1: bad input - interface: instead of interfaces:", + appJar, classlist( + "Hello", + "java/lang/Object id: 1", + "CustomLoadee interface: 1" + ), + "Unknown input:"); + + dumpShouldFail( + "TESTCASE A2: bad input - negative IDs not allowed", + appJar, classlist( + "Hello", + "java/lang/Object id: -1" + ), + "Error: negative integers not allowed"); + + dumpShouldFail( + "TESTCASE A3: bad input - bad ID (not an integer)", + appJar, classlist( + "Hello", + "java/lang/Object id: xyz" + ), + "Error: expected integer"); + + if (false) { + // FIXME - classFileParser.cpp needs fixing. + dumpShouldFail( + "TESTCASE A4: bad input - bad ID (integer too big)", + appJar, classlist( + "Hello", + "java/lang/Object id: 2147483648" // <- this is 0x80000000 + ), + "Error: expected integer"); + + // FIXME + dumpShouldFail( + "TESTCASE A5: bad input - bad ID (integer too big)", + appJar, classlist( + "Hello", + "java/lang/Object id: 21474836489" // bigger than 32-bit! + ), + "Error: expected integer"); + } + + // Good input: + dumpShouldPass( + "TESTCASE A6: extraneous spaces, tab characters and trailing new line characters", + appJar, classlist( + "Hello ", // trailing spaces + "java/lang/Object\tid:\t1", // \t instead of ' ' + "CustomLoadee id: 2 super: 1 source: " + customJarPath, + "CustomInterface2_ia id: 3 super: 1 source: " + customJarPath + " ", + "CustomInterface2_ib id: 4 super: 1 source: " + customJarPath + "\t\t\r" , + "CustomLoadee2 id: 5 super: 1 interfaces: 3 4 source: " + customJarPath // preceding spaces + )); + + int _max_allowed_line = 4096; // Must match ClassListParser::_max_allowed_line in C code. + int _line_buf_extra = 10; // Must match ClassListParser::_line_buf_extra in C code. + StringBuffer sbuf = new StringBuffer(); + for (int i=0; i<_max_allowed_line+1; i++) { + sbuf.append("x"); + } + + dumpShouldFail( + "TESTCASE A7: bad input - line too long", + appJar, classlist( + sbuf.toString() + ), + "input line too long (must be no longer than " + _max_allowed_line + " chars"); + + for (int i=0; i<_line_buf_extra + 1000; i++) { + sbuf.append("X"); + } + + dumpShouldFail( + "TESTCASE A8: bad input - line too long: try to overflow C buffer", + appJar, classlist( + sbuf.toString() + ), + "input line too long (must be no longer than " + _max_allowed_line + " chars"); + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatB.java b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatB.java new file mode 100644 index 00000000000..5e24eefb8c4 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatB.java @@ -0,0 +1,74 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Tests the format checking of hotspot/src/closed/share/vm/classfile/classListParser.cpp. + * + * (NOTE: AppCDS does not support uncompressed oops) + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires (sun.arch.data.model == "64") + * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris") + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java test-classes/CustomLoadee.java test-classes/CustomLoadee2.java + * test-classes/CustomInterface2_ia.java test-classes/CustomInterface2_ib.java + * @run main ClassListFormatB + */ + +public class ClassListFormatB extends ClassListFormatBase { + static { + // Uncomment the following line to run only one of the test cases + // ClassListFormatBase.RUN_ONLY_TEST = "TESTCASE B1"; + } + + public static void main(String[] args) throws Throwable { + String appJar = JarBuilder.getOrCreateHelloJar(); + String customJarPath = JarBuilder.build("ClassListFormatB", "CustomLoadee", + "CustomLoadee2", "CustomInterface2_ia", "CustomInterface2_ib"); + //---------------------------------------------------------------------- + // TESTGROUP B if source IS specified + //---------------------------------------------------------------------- + dumpShouldFail( + "TESTCASE B1: if source: is specified, must specify super:", + appJar, classlist( + "Hello", + "java/lang/Object id: 1", + "CustomLoadee id: 2 source: " + customJarPath + ), + "If source location is specified, super class must be also specified"); + + dumpShouldFail( + "TESTCASE B2: if source: is specified, must specify id:", + appJar, classlist( + "Hello", + "java/lang/Object id: 1", + "CustomLoadee super: 1 source: " + customJarPath + ), + "If source location is specified, id must be also specified"); + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatBase.java b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatBase.java new file mode 100644 index 00000000000..7b1301c0137 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatBase.java @@ -0,0 +1,82 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import jdk.test.lib.process.OutputAnalyzer; + +/** + * Base class for ClassListFormat[A,B,C...].java + */ +public class ClassListFormatBase { + protected static String RUN_ONLY_TEST = null; + + static void dumpShouldFail(String caseHelp, String appJar, String[] appClasses, + String... expected_errors) throws Throwable { + if (RUN_ONLY_TEST != null && !caseHelp.startsWith(RUN_ONLY_TEST)) { + System.out.println("Skipped via RUN_ONLY_TEST: " + caseHelp); + return; + } + System.out.println("------------------------------"); + System.out.println(caseHelp); + System.out.println("------------------------------"); + + try { + OutputAnalyzer output = TestCommon.dump(appJar, appClasses); + output.shouldHaveExitValue(1); + for (String s : expected_errors) { + output.shouldContain(s); + } + } catch (Throwable t) { + System.out.println("FAILED CASE: " + caseHelp); + throw t; + } + } + + static void dumpShouldPass(String caseHelp, String appJar, String[] appClasses, + String... expected_msgs) throws Throwable { + if (RUN_ONLY_TEST != null && !caseHelp.startsWith(RUN_ONLY_TEST)) { + System.out.println("Skipped via RUN_ONLY_TEST: " + caseHelp); + return; + } + System.out.println("------------------------------"); + System.out.println(caseHelp); + System.out.println("------------------------------"); + + try { + OutputAnalyzer output = TestCommon.dump(appJar, appClasses); + output.shouldHaveExitValue(0); + output.shouldContain("Dumping"); + for (String s : expected_msgs) { + output.shouldContain(s); + } + } catch (Throwable t) { + System.out.println("FAILED CASE: " + caseHelp); + throw t; + } + } + + static String[] classlist(String... args) { + return TestCommon.list(args); + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatC.java b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatC.java new file mode 100644 index 00000000000..ab2006db56b --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatC.java @@ -0,0 +1,76 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Tests the format checking of hotspot/src/closed/share/vm/classfile/classListParser.cpp. + * + * (NOTE: AppCDS does not support uncompressed oops) + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires (sun.arch.data.model == "64") + * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris") + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java test-classes/CustomLoadee.java test-classes/CustomLoadee2.java + * test-classes/CustomInterface2_ia.java test-classes/CustomInterface2_ib.java + * @run main ClassListFormatC + */ + +public class ClassListFormatC extends ClassListFormatBase { + static { + // Uncomment the following line to run only one of the test cases + // ClassListFormatBase.RUN_ONLY_TEST = "TESTCASE C1"; + } + + public static void main(String[] args) throws Throwable { + String appJar = JarBuilder.getOrCreateHelloJar(); + String customJarPath = JarBuilder.build("ClassListFormatC", "CustomLoadee", + "CustomLoadee2", "CustomInterface2_ia", + "CustomInterface2_ib"); + + //---------------------------------------------------------------------- + // TESTGROUP C: if source IS NOT specified + //---------------------------------------------------------------------- + dumpShouldFail( + "TESTCASE C1: if source: is NOT specified, must NOT specify super:", + appJar, classlist( + "Hello", + "java/lang/Object id: 1", + "CustomLoadee super: 1" + ), + "If source location is not specified, super class must not be specified"); + + dumpShouldFail( + "TESTCASE C2: if source: is NOT specified, must NOT specify interface:", + appJar, classlist( + "Hello", + "java/lang/Object id: 1", + "CustomLoadee interfaces: 1" + ), + "If source location is not specified, interface(s) must not be specified"); + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatD.java b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatD.java new file mode 100644 index 00000000000..ed379a04629 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatD.java @@ -0,0 +1,85 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Tests the format checking of hotspot/src/closed/share/vm/classfile/classListParser.cpp. + * + * (NOTE: AppCDS does not support uncompressed oops) + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires (sun.arch.data.model == "64") + * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris") + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java test-classes/CustomLoadee.java test-classes/CustomLoadee2.java + * test-classes/CustomInterface2_ia.java test-classes/CustomInterface2_ib.java + * @run main ClassListFormatD + */ + +public class ClassListFormatD extends ClassListFormatBase { + static { + // Uncomment the following line to run only one of the test cases + // ClassListFormatBase.RUN_ONLY_TEST = "TESTCASE D1"; + } + + public static void main(String[] args) throws Throwable { + String appJar = JarBuilder.getOrCreateHelloJar(); + String customJarPath = JarBuilder.build("ClassListFormatD", "CustomLoadee", + "CustomLoadee2", "CustomInterface2_ia", + "CustomInterface2_ib"); + + //---------------------------------------------------------------------- + // TESTGROUP D: bad use of IDs + //---------------------------------------------------------------------- + dumpShouldFail( + "TESTCASE D1: duplicated id:", + appJar, classlist( + "Hello", + "java/lang/Object id: 1", + "CustomLoadee id: 1 super: 1 source: " + customJarPath + ), + "Duplicated ID 1 for class CustomLoadee"); + + dumpShouldFail( + "TESTCASE D2: bad ID for super:", + appJar, classlist( + "Hello", + "java/lang/Object id: 1", + "CustomLoadee id: 2 super: 2 source: " + customJarPath + ), + "Super class id 2 is not yet loaded"); + + dumpShouldFail( + "TESTCASE D3: bad ID in interfaces:", + appJar, classlist( + "Hello", + "java/lang/Object id: 1", + "CustomLoadee id: 2 super: 1 interfaces: 2 source: " + customJarPath + ), + "Interface id 2 is not yet loaded"); + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatE.java b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatE.java new file mode 100644 index 00000000000..f17ad47ab83 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatE.java @@ -0,0 +1,111 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Tests the format checking of hotspot/src/closed/share/vm/classfile/classListParser.cpp. + * + * (NOTE: AppCDS does not support uncompressed oops) + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires (sun.arch.data.model == "64") + * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris") + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/Hello.java test-classes/CustomLoadee.java test-classes/CustomLoadee2.java + * test-classes/CustomInterface2_ia.java test-classes/CustomInterface2_ib.java + * @run main ClassListFormatE + */ + +public class ClassListFormatE extends ClassListFormatBase { + static { + // Uncomment the following line to run only one of the test cases + // ClassListFormatBase.RUN_ONLY_TEST = "TESTCASE E1"; + } + + public static void main(String[] args) throws Throwable { + String appJar = JarBuilder.getOrCreateHelloJar(); + String customJarPath = JarBuilder.build("ClassListFormatE", "CustomLoadee", + "CustomLoadee2", "CustomInterface2_ia", + "CustomInterface2_ib"); + + //---------------------------------------------------------------------- + // TESTGROUP E: super class and interfaces + //---------------------------------------------------------------------- + dumpShouldFail( + "TESTCASE E1: missing interfaces: keyword", + appJar, classlist( + "Hello", + "java/lang/Object id: 1", + "CustomLoadee2 id: 1 super: 1 source: " + customJarPath + ), + "Class CustomLoadee2 implements the interface CustomInterface2_ia, but no interface has been specified in the input line"); + + dumpShouldFail( + "TESTCASE E2: missing one interface", + appJar, classlist( + "Hello", + "java/lang/Object id: 1", + "CustomInterface2_ia id: 2 super: 1 source: " + customJarPath, + "CustomInterface2_ib id: 3 super: 1 source: " + customJarPath, + "CustomLoadee2 id: 4 super: 1 interfaces: 2 source: " + customJarPath + ), + "The interface CustomInterface2_ib implemented by class CustomLoadee2 does not match any of the specified interface IDs"); + + dumpShouldFail( + "TESTCASE E3: specifying an interface that's not implemented by the class", + appJar, classlist( + "Hello", + "java/lang/Object id: 1", + "CustomInterface2_ia id: 2 super: 1 source: " + customJarPath, + "CustomLoadee id: 2 super: 1 interfaces: 2 source: " + customJarPath + ), + "The number of interfaces (1) specified in class list does not match the class file (0)"); + + dumpShouldFail( + "TESTCASE E4: repeating an ID in the interfaces: keyword", + appJar, classlist( + "Hello", + "java/lang/Object id: 1", + "CustomInterface2_ia id: 2 super: 1 source: " + customJarPath, + "CustomInterface2_ib id: 3 super: 1 source: " + customJarPath, + "CustomLoadee2 id: 4 super: 1 interfaces: 2 2 3 source: " + customJarPath + ), + "The number of interfaces (3) specified in class list does not match the class file (2)"); + + dumpShouldFail( + "TESTCASE E5: wrong super class", + appJar, classlist( + "Hello", + "java/lang/Object id: 1", + "CustomInterface2_ia id: 2 super: 1 source: " + customJarPath, + "CustomInterface2_ib id: 3 super: 1 source: " + customJarPath, + "CustomLoadee id: 4 super: 1 source: " + customJarPath, + "CustomLoadee2 id: 5 super: 4 interfaces: 2 3 source: " + customJarPath + ), + "The specified super class CustomLoadee (id 4) does not match actual super class java.lang.Object"); + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/customLoader/CustomLoaderApp.java b/test/hotspot/jtreg/runtime/appcds/customLoader/CustomLoaderApp.java new file mode 100644 index 00000000000..0075529e8f5 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/customLoader/CustomLoaderApp.java @@ -0,0 +1,110 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +// This is a utlitity test class for loading classes-under-test +// by means of custom class loader. +// See AppCDS/jvmti/transformRelatedClasses/TransformRelatedClasses.java +// for an example. +// Use this test app in conjunction with other tests +// to load and exercise classes using custom class loader(s). +// This class is intended to be called by the "main test driver" +// inside a child process, normally with sharing enabled. +// +// Arguments: customJarPath, loaderType, testClass +// customJarPath - a path to jar file containing classes for +// loading via this custom class loader, including the +// testClass +// loaderType - Currently only "unregistered" +// (Fingerprint verification method) is allowed +// testClass - the class to be loader; the test method with +// signature 'public static void test()' will be called +// on this class, so class must contain such method + + +import java.io.File; +import java.lang.reflect.Method; +import java.net.URL; +import java.net.URLClassLoader; +import java.util.logging.Logger; + +public class CustomLoaderApp { + public static void ping() {}; + + private static void log(String msg) { + System.out.println("CustomLoaderApp: " + msg); + } + + public static void main(String[] args) throws Exception { + String path = args[0]; + URL url = new File(path).toURI().toURL(); + URL[] urls = new URL[] {url}; + + String loaderType = args[1]; + log("loaderType = " + loaderType); + + String testClass = args[2]; + log("testClass = " + testClass); + + switch(loaderType) { + case "unregistered": + loadAndUseWithUnregisteredLoader(urls, testClass); + break; + default: + throw new IllegalArgumentException("loader type is wrong: " + loaderType); + } + } + + + // Load the test classes using unregistered loader + // (i.e. loader that is not using AppCDS API) + private static void loadAndUseWithUnregisteredLoader(URL[] urls, String testClass) + throws Exception { + URLClassLoader urlClassLoader = new URLClassLoader(urls); + callTestMethod(loadAndCheck(urlClassLoader, testClass)); + } + + private static Class loadAndCheck(ClassLoader loader, String className) + throws ClassNotFoundException { + Class c = loader.loadClass(className); + log("class =" + c); + log("loader = " + c.getClassLoader()); + + // Check that c is defined by the correct loader + if (c.getClassLoader() != loader) { + String msg = String.format("c.getClassLoader() equals to <%s>, expected <%s>", + c.getClassLoader(), loader); + throw new RuntimeException(msg); + } + return c; + } + + private static void callTestMethod(Class c) throws Exception { + Method[] methods = c.getDeclaredMethods(); + for (Method m : methods) { + log("method = " + m.getName()); + if (m.getName().equals("test")) + m.invoke(null); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/customLoader/HelloCustom.java b/test/hotspot/jtreg/runtime/appcds/customLoader/HelloCustom.java new file mode 100644 index 00000000000..0d5257df89b --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/customLoader/HelloCustom.java @@ -0,0 +1,75 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Hello World test for AppCDS custom loader support + * (NOTE: AppCDS does not support uncompressed oops) + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires (sun.arch.data.model == "64") + * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris") + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * java.management + * @compile test-classes/Hello.java test-classes/CustomLoadee.java + * @build sun.hotspot.WhiteBox + * @run main ClassFileInstaller -jar hello.jar Hello + * @run main ClassFileInstaller -jar hello_custom.jar CustomLoadee + * @run main ClassFileInstaller -jar WhiteBox.jar sun.hotspot.WhiteBox + * @run main HelloCustom + */ + +import jdk.test.lib.process.OutputAnalyzer; +import sun.hotspot.WhiteBox; + +public class HelloCustom { + public static void main(String[] args) throws Exception { + String wbJar = ClassFileInstaller.getJarPath("WhiteBox.jar"); + String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar; + + String appJar = ClassFileInstaller.getJarPath("hello.jar"); + String customJarPath = ClassFileInstaller.getJarPath("hello_custom.jar"); + + // Dump the archive + String classlist[] = new String[] { + "Hello", + "java/lang/Object id: 1", + "CustomLoadee id: 2 super: 1 source: " + customJarPath + }; + + OutputAnalyzer output; + TestCommon.testDump(appJar, classlist, + // command-line arguments ... + use_whitebox_jar); + + output = TestCommon.exec(appJar, + // command-line arguments ... + use_whitebox_jar, + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", + "Hello", customJarPath); + TestCommon.checkExec(output); + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/customLoader/LoaderSegregationTest.java b/test/hotspot/jtreg/runtime/appcds/customLoader/LoaderSegregationTest.java new file mode 100644 index 00000000000..52a573f1885 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/customLoader/LoaderSegregationTest.java @@ -0,0 +1,125 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Check that during dumping, the classes for BOOT/EXT/APP loaders are segregated from the + * custom loader classes. + * (NOTE: AppCDS does not support uncompressed oops) + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires (sun.arch.data.model == "64") + * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris") + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * @compile test-classes/LoaderSegregation.java + * test-classes/CustomLoadee.java test-classes/CustomLoadee2.java + * test-classes/CustomInterface2_ia.java test-classes/CustomInterface2_ib.java + * test-classes/CustomLoadee3.java test-classes/CustomLoadee3Child.java + * test-classes/OnlyBuiltin.java + * test-classes/OnlyUnregistered.java + * ../test-classes/Util.java + * @build sun.hotspot.WhiteBox + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @run main LoaderSegregationTest + */ + +import jdk.test.lib.process.OutputAnalyzer; +import sun.hotspot.WhiteBox; + +/** + * See "Handling of the classes in the AppCDS archive" at the top of + * systemDicrionatyShared.hpp. + * + * This test ensure that the 2 types of archived classes (BUILTIN and UNREGISTERED) + * are segregated at both dump-time and run time: + * + * [A] An archived BUILTIN class cannot be a subclass of a non-BUILTIN class. + * [B] An archived BUILTIN class cannot implement a non-BUILTIN interface. + * [C] BUILTIN and UNREGISTERED classes can be loaded only by their corresponding + * type of loaders. + * + */ +public class LoaderSegregationTest { + public static void main(String[] args) throws Exception { + String wbJar = JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox"); + String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar; + + String appJar = JarBuilder.build("LoaderSegregation_app", "LoaderSegregation", + "CustomLoadee", "CustomLoadee2", "CustomLoadee3Child", "CustomInterface2_ia", + "OnlyBuiltin", "Util"); + + String app2Jar = JarBuilder.build("LoaderSegregation_app2", "CustomLoadee3", "CustomInterface2_ib"); + + String customJarPath = JarBuilder.build("LoaderSegregation_custom", "CustomLoadee", + "CustomLoadee2", "CustomInterface2_ia", "CustomInterface2_ib", + "CustomLoadee3", "CustomLoadee3Child", + "OnlyBuiltin", "OnlyUnregistered"); + + // Dump the archive + String classlist[] = new String[] { + "LoaderSegregation", + "java/lang/Object id: 1", + + // These are the UNREGISTERED classes: they have "source:" + // but they don't have "loader:". + "CustomLoadee id: 2 super: 1 source: " + customJarPath, + + "CustomInterface2_ia id: 3 super: 1 source: " + customJarPath, + "CustomInterface2_ib id: 4 super: 1 source: " + customJarPath, + "CustomLoadee2 id: 5 super: 1 interfaces: 3 4 source: " + customJarPath, + + "CustomLoadee3 id: 6 super: 1 source: " + customJarPath, + "CustomLoadee3Child id: 7 super: 6 source: " + customJarPath, + + // At dump time, the following BUILTIN classes are loaded after the UNREGISTERED + // classes from above. However, at dump time, they cannot use the UNREGISTERED classes are their + // super or interface. + "CustomLoadee", // can be loaded at dump time + "CustomLoadee2", // cannot be loaded at dump time (interface missing) + "CustomLoadee3Child", // cannot be loaded at dump time (super missing) + + // Check that BUILTIN and UNREGISTERED classes can be loaded only by their + // corresponding type of loaders. + "OnlyBuiltin", + "OnlyUnregistered id: 9 super: 1 source: " + customJarPath, + }; + + OutputAnalyzer output; + TestCommon.testDump(appJar, classlist, + // command-line arguments ... + use_whitebox_jar); + + output = TestCommon.exec(TestCommon.concatPaths(appJar, app2Jar), + // command-line arguments ... + "--add-opens=java.base/java.lang=ALL-UNNAMED", + "--add-opens=java.base/java.security=ALL-UNNAMED", + use_whitebox_jar, + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", + "LoaderSegregation", customJarPath); + TestCommon.checkExec(output); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/customLoader/ParallelTestBase.java b/test/hotspot/jtreg/runtime/appcds/customLoader/ParallelTestBase.java new file mode 100644 index 00000000000..a536d831a27 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ParallelTestBase.java @@ -0,0 +1,99 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import jdk.test.lib.process.OutputAnalyzer; + +/* + * This is a base class for the following test cases: + * ParallelTestMultiFP.java + * ParallelTestSingleFP.java + */ +public class ParallelTestBase { + public static final int MAX_CLASSES = 40; // must match ../test-classes/ParallelLoad.java + public static int NUM_THREADS = 4; // must match ../test-classes/ParallelLoad.java + + public static final int SINGLE_CUSTOM_LOADER = 1; + public static final int MULTI_CUSTOM_LOADER = 2; + + public static final int FINGERPRINT_MODE = 1; + + public static void run(String[] args, int loaderType, int mode) throws Exception { + String[] cust_classes = new String[MAX_CLASSES]; + String[] cust_list; + + if (mode == FINGERPRINT_MODE) { + cust_list = new String[MAX_CLASSES]; + } else { + cust_list = new String[MAX_CLASSES * NUM_THREADS]; + } + + for (int i = 0; i argsList = new ArrayList(); + argsList.add("-XX:+UnlockDiagnosticVMOptions"); + argsList.add("-XX:+WhiteBoxAPI"); + argsList.add("-cp"); + argsList.add(appJar); + argsList.add(bootClassPath); + argsList.add("-verbose:class"); + argsList.add("ArrayTestHelper"); + // the following are input args to the ArrayTestHelper. + for (int i = 0; i < arrayClasses.length; i++) { + argsList.add(arrayClasses[i]); + } + String[] opts = new String[argsList.size()]; + opts = argsList.toArray(opts); + OutputAnalyzer output = TestCommon.execCommon(opts); + TestCommon.checkExec(output); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/javaldr/ArrayTestHelper.java b/test/hotspot/jtreg/runtime/appcds/javaldr/ArrayTestHelper.java new file mode 100644 index 00000000000..614f47e6546 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/javaldr/ArrayTestHelper.java @@ -0,0 +1,46 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +public class ArrayTestHelper { + public static void main(String[] args) throws Throwable { + + // load the classes one by one and ensure each one is from + // the shared archive + for (int i = 0; i < args.length; i++) { + + String cn = args[i].replace('/', '.'); + Class cls = Class.forName(cn); + + WhiteBox wb = WhiteBox.getWhiteBox(); + if (wb.isSharedClass(cls)) { + System.out.println("As expected, " + args[i] + " is in shared space."); + } else { + throw new java.lang.RuntimeException(args[i] + " is not in shared space."); + } + } + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/javaldr/CheckAnonymousClass.java b/test/hotspot/jtreg/runtime/appcds/javaldr/CheckAnonymousClass.java new file mode 100644 index 00000000000..804c480cd74 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/javaldr/CheckAnonymousClass.java @@ -0,0 +1,75 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary ensure no anonymous class is being dumped into the CDS archive + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules jdk.jartool/sun.tools.jar + * @compile ../test-classes/Hello.java + * @run main CheckAnonymousClass + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class CheckAnonymousClass { + + public static void main(String[] args) throws Exception { + JarBuilder.build("hello", "Hello"); + + String appJar = TestCommon.getTestJar("hello.jar"); + + TestCommon.dump(appJar, TestCommon.list("Hello", "org/omg/CORBA/ORB"), + "--add-modules", "java.corba", "-Xlog:class+load=info"); + + OutputAnalyzer output = TestCommon.execCommon("-XX:+UnlockDiagnosticVMOptions", + "-cp", appJar, "-Xlog:class+load=info", "--add-modules", "java.corba", "Hello"); + + String prefix = ".class.load. "; + // class name pattern like the following: + // jdk.internal.loader.BuiltinClassLoader$$Lambda$1/1816757085 + // java.lang.invoke.LambdaForm$MH/1585787493 + String class_pattern = ".*Lambda([a-z0-9$]+)/([0-9]+).*"; + String suffix = ".*source: shared objects file.*"; + String pattern = prefix + class_pattern + suffix; + // during run time, anonymous classes shouldn't be loaded from the archive + try { + output.shouldNotMatch(pattern); + } catch (Exception e) { + TestCommon.checkCommonExecExceptions(output, e); + } + + // inspect the archive and make sure no anonymous class is in there + output = TestCommon.execCommon("-XX:+UnlockDiagnosticVMOptions", + "-cp", appJar, "-Xlog:class+load=info", "-XX:+PrintSharedArchiveAndExit", + "-XX:+PrintSharedDictionary", "--add-modules", "java.corba", "Hello"); + try { + output.shouldNotMatch(class_pattern); + } catch (Exception e) { + TestCommon.checkCommonExecExceptions(output, e); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDump.java b/test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDump.java new file mode 100644 index 00000000000..22a7dad0a6d --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDump.java @@ -0,0 +1,80 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary When dumping the CDS archive, try to cause garbage collection while classes are being loaded. + * @library /test/lib /test/hotspot/jtreg/runtime/appcds /test/hotspot/jtreg/runtime/appcds/test-classes + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.flavor != "minimal" + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * java.management + * @build GCDuringDumpTransformer Hello + * @run main/othervm GCDuringDump + */ + +import jdk.test.lib.cds.CDSOptions; +import jdk.test.lib.process.OutputAnalyzer; +import jdk.test.lib.process.ProcessTools; + +public class GCDuringDump { + public static String appClasses[] = { + "Hello", + }; + public static String agentClasses[] = { + "GCDuringDumpTransformer", + }; + + public static void main(String[] args) throws Throwable { + String agentJar = + ClassFileInstaller.writeJar("GCDuringDumpTransformer.jar", + ClassFileInstaller.Manifest.fromSourceFile("GCDuringDumpTransformer.mf"), + agentClasses); + + String appJar = + ClassFileInstaller.writeJar("GCDuringDumpApp.jar", appClasses); + + String gcLog = "-Xlog:gc*=info,gc+region=trace,gc+alloc+region=debug"; + + for (int i=0; i<2; i++) { + // i = 0 -- run without agent = no extra GCs + // i = 1 -- run with agent = cause extra GCs + + String extraArg = (i == 0) ? "-showversion" : "-javaagent:" + agentJar; + + TestCommon.testDump(appJar, TestCommon.list("Hello"), + extraArg, "-Xmx32m", gcLog); + + OutputAnalyzer output = TestCommon.execCommon( + "-cp", appJar, + "-Xmx32m", + "-XX:+PrintSharedSpaces", + gcLog, + "Hello"); + TestCommon.checkExec(output); + } + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDumpTransformer.java b/test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDumpTransformer.java new file mode 100644 index 00000000000..bbde62429c4 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDumpTransformer.java @@ -0,0 +1,72 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.lang.instrument.ClassFileTransformer; +import java.lang.instrument.Instrumentation; +import java.lang.instrument.IllegalClassFormatException; +import java.security.ProtectionDomain; + +public class GCDuringDumpTransformer implements ClassFileTransformer { + static int n = 0; + public byte[] transform(ClassLoader loader, String name, Class classBeingRedefined, + ProtectionDomain pd, byte[] buffer) throws IllegalClassFormatException { + n++; + + System.out.println("dump time loading: " + name + " in loader: " + loader); + System.out.println("making garbage: " + n); + try { + makeGarbage(); + } catch (Throwable t) { + t.printStackTrace(); + try { + Thread.sleep(200); // let GC to have a chance to run + } catch (Throwable t2) {} + } + System.out.println("making garbage: done"); + + return null; + } + + private static Instrumentation savedInstrumentation; + + public static void premain(String agentArguments, Instrumentation instrumentation) { + System.out.println("ClassFileTransformer.premain() is called"); + instrumentation.addTransformer(new GCDuringDumpTransformer(), /*canRetransform=*/true); + savedInstrumentation = instrumentation; + } + + public static Instrumentation getInstrumentation() { + return savedInstrumentation; + } + + public static void agentmain(String args, Instrumentation inst) throws Exception { + premain(args, inst); + } + + public static void makeGarbage() { + for (int x=0; x<10; x++) { + Object[] a = new Object[10000]; + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDumpTransformer.mf b/test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDumpTransformer.mf new file mode 100644 index 00000000000..8b44e6e9801 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDumpTransformer.mf @@ -0,0 +1,5 @@ +Manifest-Version: 1.0 +Premain-Class: GCDuringDumpTransformer +Agent-Class: GCDuringDumpTransformer +Can-Retransform-Classes: true +Can-Redefine-Classes: true diff --git a/test/hotspot/jtreg/runtime/appcds/javaldr/GCSharedStringsDuringDump.java b/test/hotspot/jtreg/runtime/appcds/javaldr/GCSharedStringsDuringDump.java new file mode 100644 index 00000000000..38e23c31a30 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/javaldr/GCSharedStringsDuringDump.java @@ -0,0 +1,131 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Similar to GCDuringDumping.java, this test adds the -XX:SharedArchiveConfigFile + * option for testing the interaction with GC and shared strings. + * @library /test/lib /test/hotspot/jtreg/runtime/appcds /test/hotspot/jtreg/runtime/appcds/test-classes + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.flavor != "minimal" + * @requires vm.gc.G1 + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * java.management + * @build sun.hotspot.WhiteBox GCDuringDumpTransformer GCSharedStringsDuringDumpWb + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @run main/othervm/timeout=480 GCSharedStringsDuringDump + */ + +import java.io.File; +import java.io.FileOutputStream; +import java.io.OutputStreamWriter; +import java.io.PrintWriter; +import jdk.test.lib.cds.CDSOptions; +import jdk.test.lib.process.OutputAnalyzer; +import jdk.test.lib.process.ProcessTools; +import sun.hotspot.WhiteBox; + +public class GCSharedStringsDuringDump { + public static String appClasses[] = { + "GCSharedStringsDuringDumpWb", + }; + public static String agentClasses[] = { + "GCDuringDumpTransformer", + }; + + public static void main(String[] args) throws Throwable { + String agentJar = + ClassFileInstaller.writeJar("GCDuringDumpTransformer.jar", + ClassFileInstaller.Manifest.fromSourceFile("GCDuringDumpTransformer.mf"), + agentClasses); + + String appJar = + ClassFileInstaller.writeJar("GCSharedStringsDuringDumpApp.jar", appClasses); + + String gcLog = "-Xlog:gc*=info,gc+region=trace,gc+alloc+region=debug"; + + String sharedArchiveCfgFile = + System.getProperty("user.dir") + File.separator + "GCSharedStringDuringDump_gen.txt"; + try (FileOutputStream fos = new FileOutputStream(sharedArchiveCfgFile)) { + PrintWriter out = new PrintWriter(new OutputStreamWriter(fos)); + out.println("VERSION: 1.0"); + out.println("@SECTION: String"); + out.println("31: shared_test_string_unique_14325"); + for (int i=0; i<100000; i++) { + String s = "generated_string " + i; + out.println(s.length() + ": " + s); + } + out.close(); + } + + JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox"); + String whiteBoxJar = TestCommon.getTestJar("WhiteBox.jar"); + String bootClassPath = "-Xbootclasspath/a:" + whiteBoxJar; + + for (int i=0; i<2; i++) { + // i = 0 -- run without agent = no extra GCs + // i = 1 -- run with agent = cause extra GCs + + String extraArg = (i == 0) ? "-showversion" : "-javaagent:" + agentJar; + + OutputAnalyzer output = TestCommon.dump( + appJar, TestCommon.list("GCSharedStringsDuringDumpWb"), + bootClassPath, extraArg, "-Xmx32m", gcLog, + "-XX:+UseCompressedOops", "-XX:+UseG1GC", + "-XX:SharedReadOnlySize=30m", + "-XX:SharedArchiveConfigFile=" + sharedArchiveCfgFile); + + if (output.getStdout().contains("Too many string space regions") || + output.getStderr().contains("Unable to write archive heap memory regions") || + output.getStdout().contains("Try increasing NewSize") || + output.getExitValue() != 0) { + // Try again with larger heap and NewSize, this should increase the + // G1 heap region size to 2M + TestCommon.testDump( + appJar, TestCommon.list("GCSharedStringsDuringDumpWb"), + bootClassPath, extraArg, "-Xmx8g", "-XX:NewSize=8m", gcLog, + "-XX:+UseCompressedOops", "-XX:+UseG1GC", + "-XX:SharedReadOnlySize=30m", + "-XX:SharedArchiveConfigFile=" + sharedArchiveCfgFile); + } + + output = TestCommon.execCommon( + "-cp", appJar, + bootClassPath, + "-Xmx32m", + "-XX:+PrintSharedSpaces", + "-XX:+UseCompressedOops", + "-XX:+UseG1GC", + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", + "-XX:SharedReadOnlySize=30m", + gcLog, + "GCSharedStringsDuringDumpWb"); + TestCommon.checkExec(output); + } + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/javaldr/GCSharedStringsDuringDumpWb.java b/test/hotspot/jtreg/runtime/appcds/javaldr/GCSharedStringsDuringDumpWb.java new file mode 100644 index 00000000000..3fcebe5f5ed --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/javaldr/GCSharedStringsDuringDumpWb.java @@ -0,0 +1,45 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +public class GCSharedStringsDuringDumpWb { + public static void main(String[] args) throws Exception { + WhiteBox wb = WhiteBox.getWhiteBox(); + String s = "shared_test_string_unique_14325"; + s = s.intern(); + CheckString(wb, s); + for (int i=0; i<100000; i++) { + s = "generated_string " + i; + s = s.intern(); + CheckString(wb, s); + } + } + + public static void CheckString(WhiteBox wb, String s) { + if (!wb.areSharedStringsIgnored() && !wb.isShared(s)) { + throw new RuntimeException("String is not shared."); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/CheckUnsupportedDumpingOptions.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/CheckUnsupportedDumpingOptions.java new file mode 100644 index 00000000000..99efbcbf135 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/CheckUnsupportedDumpingOptions.java @@ -0,0 +1,102 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Abort dumping if any of the new jigsaw vm options is specified. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib .. + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * jdk.internal.jvmstat/sun.jvmstat.monitor + * @compile ../test-classes/Hello.java + * @run main CheckUnsupportedDumpingOptions + */ + +import jdk.test.lib.compiler.InMemoryJavaCompiler; +import jdk.test.lib.process.OutputAnalyzer; + +public class CheckUnsupportedDumpingOptions { + private static final String[] jigsawOptions = { + "-m", + "--limit-modules", + "--module-path", + "--upgrade-module-path", + "--patch-module" + }; + private static final String[] optionValues = { + "mymod", + "mymod", + "mydir", + ".", + "java.naming=javax.naming.spi.NamingManger" + }; + private static final int infoIdx = 1; + + public static void main(String[] args) throws Exception { + String source = "package javax.naming.spi; " + + "public class NamingManager { " + + " static { " + + " System.out.println(\"I pass!\"); " + + " } " + + "}"; + ClassFileInstaller.writeClassToDisk("javax/naming/spi/NamingManager", + InMemoryJavaCompiler.compile("javax.naming.spi.NamingManager", source, "--patch-module=java.naming"), + "mods/java.naming"); + + JarBuilder.build("hello", "Hello"); + String appJar = TestCommon.getTestJar("hello.jar"); + String appClasses[] = {"Hello"}; + for (int i = 0; i < jigsawOptions.length; i++) { + OutputAnalyzer output; + if (i == 5) { + // --patch-module + output = TestCommon.dump(appJar, appClasses, "-Xlog:cds,cds+hashtables", + jigsawOptions[i] + optionValues[i] + appJar); + } else { + output = TestCommon.dump(appJar, appClasses, "-Xlog:cds,cds+hashtables", + jigsawOptions[i], optionValues[i]); + } + if (i < infoIdx) { + output.shouldContain("Cannot use the following option " + + "when dumping the shared archive: " + jigsawOptions[i]) + .shouldHaveExitValue(1); + } else { + output.shouldContain("Info: the " + jigsawOptions[i] + + " option is ignored when dumping the shared archive"); + if (optionValues[i].equals("mymod")) { + // java will throw FindException for a module + // which cannot be found during init_phase2() of vm init + output.shouldHaveExitValue(1) + .shouldContain("java.lang.module.FindException: Module mymod not found"); + } else { + output.shouldHaveExitValue(0); + } + } + } + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/JigsawOptionsCombo.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/JigsawOptionsCombo.java new file mode 100644 index 00000000000..2513d0e5a19 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/JigsawOptionsCombo.java @@ -0,0 +1,216 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Test combinations of jigsaw options that affect the use of AppCDS + * + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib .. + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * jdk.internal.jvmstat/sun.jvmstat.monitor + * @compile ../test-classes/Hello.java ../test-classes/HelloMore.java + * @run main JigsawOptionsCombo + */ +import jdk.test.lib.compiler.InMemoryJavaCompiler; +import jdk.test.lib.process.OutputAnalyzer; +import java.util.ArrayList; + + +// Remaining WORK: TODO: +// 1. test with -m initial-module; waiting for changes from Chris will provide +// utils to build modules +// 2. Loading classes from Jmod files - waiting on utils +// 3. Loading classes from exploded module dir" + +public class JigsawOptionsCombo { + + public static void main(String[] args) throws Exception { + String source = "package javax.naming.spi; " + + "public class NamingManager { " + + " static { " + + " System.out.println(\"I pass!\"); " + + " } " + + "}"; + ClassFileInstaller.writeClassToDisk("javax/naming/spi/NamingManager", + InMemoryJavaCompiler.compile("javax.naming.spi.NamingManager", source, "--patch-module=java.naming"), + "mods/java.naming"); + + JarBuilder.build("hello", "Hello"); + JarBuilder.build("hello_more", "HelloMore"); + + (new JigsawOptionsCombo()).runTests(); + } + + + private ArrayList testCaseTable = new ArrayList(); + + public static String infoDuringDump(String option) { + return "Info: the " + option + + " option is ignored when dumping the shared archive"; + } + + public void runTests() throws Exception { + + testCaseTable.add(new TestCase( + "basic: Basic dump and execute, to verify the test plumbing works", + "", "", 0, + "", "", 0) ); + + String bcpArg = "-Xbootclasspath/a:" + + TestCommon.getTestJar("hello_more.jar"); + + testCaseTable.add(new TestCase( + "Xbootclasspath/a: is OK for both dump and run time", + bcpArg, "", 0, + bcpArg, "", 0) ); + + testCaseTable.add(new TestCase( + "module-path-01: --module-path is ignored for dump time", + "--module-path mods", + infoDuringDump("--module-path"), 0, + null, null, 0) ); + + testCaseTable.add(new TestCase( + "module-path-02: --module-path is ok for run time", + "", "", 0, + "--module-path mods", "", 0) ); + + testCaseTable.add(new TestCase( + "add-modules-01: --add-modules is ok at dump time", + "--add-modules java.management", + "", 0, + null, null, 0) ); + + testCaseTable.add(new TestCase( + "add-modules-02: --add-modules is ok at run time", + "", "", 0, + "--add-modules java.management", "", 0) ); + + testCaseTable.add(new TestCase( + "limit-modules-01: --limit-modules is ignored at dump time", + "--limit-modules java.base", + infoDuringDump("--limit-modules"), 0, + null, null, 0) ); + + testCaseTable.add(new TestCase( + "limit-modules-02: --limit-modules is ok at run time", + "", "", 0, + "--limit-modules java.base", "", 0) ); + + testCaseTable.add(new TestCase( + "upgrade-module-path-01: --upgrade-module-path is ignored at dump time", + "--upgrade-module-path mods", + infoDuringDump("--upgrade-module-path"), 0, + null, null, 0) ); + + testCaseTable.add(new TestCase( + "-upgrade-module-path-module-path-02: --upgrade-module-path is ok at run time", + "", "", 0, + "--upgrade-module-path mods", "", 0) ); + + for (TestCase tc : testCaseTable) tc.execute(); + } + + + // class representing a singe test case + public class TestCase { + String description; + String dumpTimeArgs; + String dumpTimeExpectedOutput; + int dumpTimeExpectedExitValue; + String runTimeArgs; + String runTimeExpectedOutput; + int runTimeExpectedExitValue; + + private String appJar = TestCommon.getTestJar("hello.jar"); + private String appClasses[] = {"Hello"}; + + + public TestCase(String description, + String dumpTimeArgs, String dumpTimeExpectedOutput, int dumpTimeExpectedExitValue, + String runTimeArgs, String runTimeExpectedOutput, int runTimeExpectedExitValue) { + + this.description = description; + this.dumpTimeArgs = dumpTimeArgs; + this.dumpTimeExpectedOutput = dumpTimeExpectedOutput; + this.dumpTimeExpectedExitValue = dumpTimeExpectedExitValue; + this.runTimeArgs = runTimeArgs; + this.runTimeExpectedOutput = runTimeExpectedOutput; + this.runTimeExpectedExitValue = runTimeExpectedExitValue; + } + + + public void execute() throws Exception { + System.out.println("Description: " + description); + + // ===== dump step - create the archive + OutputAnalyzer dumpOutput = TestCommon.dump( + appJar, appClasses, getDumpOptions()); + + if (dumpTimeExpectedExitValue == 0) { + TestCommon.checkDump(dumpOutput, dumpTimeExpectedOutput); + } else { + dumpOutput.shouldMatch(dumpTimeExpectedOutput); + dumpOutput.shouldHaveExitValue(dumpTimeExpectedExitValue); + } + + // ===== exec step - use the archive + if (runTimeArgs != null) { + OutputAnalyzer execOutput = TestCommon.exec(appJar, getRunOptions()); + + if (runTimeExpectedExitValue == 0) { + TestCommon.checkExec(execOutput, runTimeExpectedOutput, "Hello World"); + } else { + execOutput.shouldMatch(dumpTimeExpectedOutput); + execOutput.shouldHaveExitValue(dumpTimeExpectedExitValue); + } + } + } + + + // dump command line options can be separated by a space + private String[] getDumpOptions() { + return dumpTimeArgs.split(" "); + } + + + // run command line options can be separated by a space + private String[] getRunOptions() { + ArrayList result = new ArrayList<>(); + + if (runTimeArgs != "") { + String splitArgs[] = runTimeArgs.split(" "); + for (String arg : splitArgs) + result.add(arg); + } + + result.add("Hello"); + return result.toArray(new String[1]); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/AppClassInCP.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/AppClassInCP.java new file mode 100644 index 00000000000..07a09fda627 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/AppClassInCP.java @@ -0,0 +1,104 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @summary a test to demonstrate that an application class in the -cp + * will be archived although --patch-module is specified. The class in + * the -cp has no dependencies on the class in the --patch-module. + * @library ../.. + * @library /test/hotspot/jtreg/testlibrary + * @library /test/lib + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * @build PatchMain + * @run main AppClassInCP + */ + +import java.io.File; +import jdk.test.lib.compiler.InMemoryJavaCompiler; +import jdk.test.lib.process.OutputAnalyzer; + +public class AppClassInCP { + private static String moduleJar; + private static String appJar; + + public static void main(String args[]) throws Throwable { + + // Create a class file in the module java.naming. This class file + // will be put in the javanaming.jar file. + String source = "package javax.naming.spi; " + + "public class NamingManager { " + + " static { " + + " System.out.println(\"I pass!\"); " + + " } " + + "}"; + + String classDir = System.getProperty("test.classes"); + + ClassFileInstaller.writeClassToDisk("javax/naming/spi/NamingManager", + InMemoryJavaCompiler.compile("javax.naming.spi.NamingManager", source, "--patch-module=java.naming"), + classDir); + + // Build the jar file that will be used for the module "java.naming". + JarBuilder.build("javanaming", "javax/naming/spi/NamingManager"); + moduleJar = TestCommon.getTestJar("javanaming.jar"); + + String source2 = "package mypackage; " + + "public class Hello { " + + " static { " + + " System.out.println(\"Hello!\"); " + + " } " + + "}"; + ClassFileInstaller.writeClassToDisk("mypackage/Hello", + InMemoryJavaCompiler.compile("mypackage.Hello", source2), + classDir); + + JarBuilder.build("hello", "mypackage/Hello"); + appJar = TestCommon.getTestJar("hello.jar"); + + System.out.println("Test dumping with --patch-module"); + OutputAnalyzer output = + TestCommon.dump(appJar, + TestCommon.list("javax/naming/spi/NamingManager", "mypackage/Hello"), + "--patch-module=java.naming=" + moduleJar, + "-Xlog:class+load", + "PatchMain", "javax.naming.spi.NamingManager", "mypackage.Hello"); + TestCommon.checkDump(output, "Loading classes to share"); + + String classPath = appJar + File.pathSeparator + classDir; + System.out.println("classPath: " + classPath); + output = TestCommon.execCommon( + "-XX:+UnlockDiagnosticVMOptions", + "-cp", classPath, + "--patch-module=java.naming=" + moduleJar, + "-Xlog:class+load", + "PatchMain", "javax.naming.spi.NamingManager", "mypackage.Hello"); + TestCommon.checkExec(output, + "I pass!", + "Hello!", + "Hello source: shared objects file"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/CustomPackage.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/CustomPackage.java new file mode 100644 index 00000000000..9f6fbbb2ad1 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/CustomPackage.java @@ -0,0 +1,83 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @summary if a class is defined to a package which is not defined to any + * module in the jimage, the class will not be found during dump + * time but it will be used during run time. + * @library ../.. + * @library /test/hotspot/jtreg/testlibrary + * @library /test/lib + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * @build PatchMain + * @run main CustomPackage + */ + +import jdk.test.lib.compiler.InMemoryJavaCompiler; +import jdk.test.lib.process.OutputAnalyzer; + +public class CustomPackage { + private static String moduleJar; + + public static void main(String args[]) throws Throwable { + + // Create a class file in the module java.naming. This class file + // will be put in the javanaming.jar file. + String source = "package javax.naming.myspi; " + + "public class NamingManager { " + + " static { " + + " System.out.println(\"I pass!\"); " + + " } " + + "}"; + + ClassFileInstaller.writeClassToDisk("javax/naming/myspi/NamingManager", + InMemoryJavaCompiler.compile("javax.naming.myspi.NamingManager", source, "--patch-module=java.naming"), + System.getProperty("test.classes")); + + // Build the jar file that will be used for the module "java.naming". + JarBuilder.build("javanaming", "javax/naming/myspi/NamingManager"); + moduleJar = TestCommon.getTestJar("javanaming.jar"); + + System.out.println("Test dumping with --patch-module"); + OutputAnalyzer output = + TestCommon.dump(null, + TestCommon.list("javax/naming/myspi/NamingManager"), + "--patch-module=java.naming=" + moduleJar, + "-Xlog:class+load", + "-Xlog:class+path=info", + "PatchMain", "javax.naming.myspi.NamingManager"); + TestCommon.checkDump(output, "Preload Warning: Cannot find javax/naming/myspi/NamingManager"); + + output = TestCommon.execCommon( + "-XX:+UnlockDiagnosticVMOptions", + "--patch-module=java.naming=" + moduleJar, + "-Xlog:class+load", + "-Xlog:class+path=info", + "PatchMain", "javax.naming.myspi.NamingManager"); + TestCommon.checkExec(output, "I pass!"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/MismatchedPatchModule.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/MismatchedPatchModule.java new file mode 100644 index 00000000000..b614f58a551 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/MismatchedPatchModule.java @@ -0,0 +1,132 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @summary different settings of --patch-module at dump time and runtime are + * acceptable. The class found in runtime --patch-module entry should + * be used. + * @library ../.. + * @library /test/hotspot/jtreg/testlibrary + * @library /test/lib + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * @build PatchMain + * @run main MismatchedPatchModule + */ + +import jdk.test.lib.compiler.InMemoryJavaCompiler; +import jdk.test.lib.process.OutputAnalyzer; + +public class MismatchedPatchModule { + private static String moduleJar; + + public static void main(String args[]) throws Throwable { + + // Create a class file in the module java.naming. This class file + // will be put in the javanaming.jar file. + String source = "package javax.naming.spi; " + + "public class NamingManager { " + + " static { " + + " System.out.println(\"I pass!\"); " + + " } " + + "}"; + + ClassFileInstaller.writeClassToDisk("javax/naming/spi/NamingManager", + InMemoryJavaCompiler.compile("javax.naming.spi.NamingManager", source, "--patch-module=java.naming"), + System.getProperty("test.classes")); + + // Build the jar file that will be used for the module "java.naming". + JarBuilder.build("javanaming", "javax/naming/spi/NamingManager"); + moduleJar = TestCommon.getTestJar("javanaming.jar"); + + // Case 1: --patch-module specified for dump time and run time + System.out.println("Case 1: --patch-module specified for dump time and run time"); + OutputAnalyzer output = + TestCommon.dump(null, + TestCommon.list("javax/naming/spi/NamingManager"), + "--patch-module=java.naming=" + moduleJar, + "PatchMain", "javax.naming.spi.NamingManager"); + TestCommon.checkDump(output, "Loading classes to share"); + + // javax.naming.spi.NamingManager is not patched at runtime + output = TestCommon.execCommon( + "-XX:+UnlockDiagnosticVMOptions", + "--patch-module=java.naming2=" + moduleJar, + "-Xlog:class+path=info", + "PatchMain", "javax.naming.spi.NamingManager"); + output.shouldNotContain("I pass!"); + + // Case 2: --patch-module specified for dump time but not for run time + System.out.println("Case 2: --patch-module specified for dump time but not for run time"); + output = + TestCommon.dump(null, + TestCommon.list("javax/naming/spi/NamingManager"), + "--patch-module=java.naming=" + moduleJar, + "PatchMain", "javax.naming.spi.NamingManager"); + TestCommon.checkDump(output, "Loading classes to share"); + + // javax.naming.spi.NamingManager is not patched at runtime + output = TestCommon.execCommon( + "-XX:+UnlockDiagnosticVMOptions", + "-Xlog:class+path=info", + "PatchMain", "javax.naming.spi.NamingManager"); + output.shouldNotContain("I pass!"); + + // Case 3: --patch-module specified for run time but not for dump time + System.out.println("Case 3: --patch-module specified for run time but not for dump time"); + output = + TestCommon.dump(null, + TestCommon.list("javax/naming/spi/NamingManager"), + "PatchMain", "javax.naming.spi.NamingManager"); + TestCommon.checkDump(output, "Loading classes to share"); + + // javax.naming.spi.NamingManager is patched at runtime + output = TestCommon.execCommon( + "-XX:+UnlockDiagnosticVMOptions", + "--patch-module=java.naming=" + moduleJar, + "-Xlog:class+path=info", + "PatchMain", "javax.naming.spi.NamingManager"); + TestCommon.checkExec(output, "I pass!"); + + // Case 4: mismatched --patch-module entry counts between dump time and run time + System.out.println("Case 4: mismatched --patch-module entry counts between dump time and run time"); + output = + TestCommon.dump(null, + TestCommon.list("javax/naming/spi/NamingManager"), + "--patch-module=java.naming=" + moduleJar, + "PatchMain", "javax.naming.spi.NamingManager"); + TestCommon.checkDump(output, "Loading classes to share"); + + // javax.naming.spi.NamingManager is patched at runtime + output = TestCommon.execCommon( + "-XX:+UnlockDiagnosticVMOptions", + "--patch-module=java.naming=" + moduleJar, + "--patch-module=java.naming2=" + moduleJar, + "-Xlog:class+path=info", + "PatchMain", "javax.naming.spi.NamingManager"); + TestCommon.checkExec(output, "I pass!"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchDir.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchDir.java new file mode 100644 index 00000000000..854d4419922 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchDir.java @@ -0,0 +1,73 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @summary a simple test to ensure that a directory in the --patch-module + * option does not affect dump process + * @library ../.. + * @library /test/hotspot/jtreg/testlibrary + * @library /test/lib + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * @build PatchMain + * @run main PatchDir + */ + +import java.io.File; +import jdk.test.lib.compiler.InMemoryJavaCompiler; + +public class PatchDir { + private static String moduleJar; + + public static void main(String args[]) throws Throwable { + + // Create a class file in the module java.naming. This class file + // will be put in the javanaming.jar file. + String source = "package javax.naming.spi; " + + "public class NamingManager { " + + " static { " + + " System.out.println(\"I pass!\"); " + + " } " + + "}"; + + String classDir = System.getProperty("test.classes"); + ClassFileInstaller.writeClassToDisk("javax/naming/spi/NamingManager", + InMemoryJavaCompiler.compile("javax.naming.spi.NamingManager", source, "--patch-module=java.naming"), + classDir); + + JarBuilder.build("javanaming", "javax/naming/spi/NamingManager"); + moduleJar = TestCommon.getTestJar("javanaming.jar"); + + System.out.println("Test dumping with --patch-module"); + TestCommon.dump(null, + TestCommon.list("javax/naming/spi/NamingManager"), + "--patch-module=java.naming=" + moduleJar, + "-Xlog:class+load", + "PatchMain", "javax.naming.spi.NamingManager") + .shouldContain("Loading classes to share") + .shouldHaveExitValue(0); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchJavaBase.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchJavaBase.java new file mode 100644 index 00000000000..726cf1b7675 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchJavaBase.java @@ -0,0 +1,73 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @summary sharing is disabled if java.base is patch at runtime + * @library ../.. + * @library /test/hotspot/jtreg/testlibrary + * @library /test/lib + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * @build PatchMain + * @run main PatchJavaBase + */ + +import jdk.test.lib.compiler.InMemoryJavaCompiler; +import jdk.test.lib.process.OutputAnalyzer; + +public class PatchJavaBase { + private static String moduleJar; + + public static void main(String args[]) throws Throwable { + + String source = "package java.lang; " + + "public class NewClass { " + + " static { " + + " System.out.println(\"I pass!\"); " + + " } " + + "}"; + + ClassFileInstaller.writeClassToDisk("java/lang/NewClass", + InMemoryJavaCompiler.compile("java.lang.NewClass", source, "--patch-module=java.base"), + System.getProperty("test.classes")); + + JarBuilder.build("javabase", "java/lang/NewClass"); + moduleJar = TestCommon.getTestJar("javabase.jar"); + + System.out.println("Test dumping with --patch-module"); + OutputAnalyzer output = + TestCommon.dump(null, null, + "--patch-module=java.base=" + moduleJar, + "PatchMain", "java.lang.NewClass"); + TestCommon.checkDump(output, "Loading classes to share"); + + output = TestCommon.execCommon( + "-XX:+UnlockDiagnosticVMOptions", + "--patch-module=java.base=" + moduleJar, + "PatchMain", "java.lang.NewClass"); + output.shouldContain("CDS is disabled when java.base module is patched"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchMain.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchMain.java new file mode 100644 index 00000000000..86430957875 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchMain.java @@ -0,0 +1,33 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +// This loads the class affected by the --patch-module option. For the test to pass +// it must load the class from the --patch-module directory, not the jimage file. +public class PatchMain { + public static void main(String[] args) throws Exception { + for (int i = 0; i < args.length; i++) { + Class.forName(args[i]); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/Simple.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/Simple.java new file mode 100644 index 00000000000..80959541cfd --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/Simple.java @@ -0,0 +1,81 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @summary a simple test to ensure that class is loaded from jar file in --patch-module at runtime + * @library ../.. + * @library /test/hotspot/jtreg/testlibrary + * @library /test/lib + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * @build PatchMain + * @run main Simple + */ + +import jdk.test.lib.compiler.InMemoryJavaCompiler; +import jdk.test.lib.process.OutputAnalyzer; + +public class Simple { + private static String moduleJar; + + public static void main(String args[]) throws Throwable { + + // Create a class file in the module java.naming. This class file + // will be put in the javanaming.jar file. + String source = "package javax.naming.spi; " + + "public class NamingManager { " + + " static { " + + " System.out.println(\"I pass!\"); " + + " } " + + "}"; + + ClassFileInstaller.writeClassToDisk("javax/naming/spi/NamingManager", + InMemoryJavaCompiler.compile("javax.naming.spi.NamingManager", source, "--patch-module=java.naming"), + System.getProperty("test.classes")); + + // Build the jar file that will be used for the module "java.naming". + JarBuilder.build("javanaming", "javax/naming/spi/NamingManager"); + moduleJar = TestCommon.getTestJar("javanaming.jar"); + + System.out.println("Test dumping with --patch-module"); + OutputAnalyzer output = + TestCommon.dump(null, + TestCommon.list("javax/naming/spi/NamingManager"), + "--patch-module=java.naming=" + moduleJar, + "-Xlog:class+load", + "-Xlog:class+path=info", + "PatchMain", "javax.naming.spi.NamingManager"); + TestCommon.checkDump(output, "Loading classes to share"); + + output = TestCommon.execCommon( + "-XX:+UnlockDiagnosticVMOptions", + "--patch-module=java.naming=" + moduleJar, + "-Xlog:class+load", + "-Xlog:class+path=info", + "PatchMain", "javax.naming.spi.NamingManager"); + TestCommon.checkExec(output, "I pass!"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/SubClassOfPatchedClass.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/SubClassOfPatchedClass.java new file mode 100644 index 00000000000..de460b5f2ee --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/SubClassOfPatchedClass.java @@ -0,0 +1,105 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @summary the class in the -cp is a subclass of the class in --patch-module. The + * patched class should be used at runtime. + * @library ../.. + * @library /test/hotspot/jtreg/testlibrary + * @library /test/lib + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * @build PatchMain + * @run main SubClassOfPatchedClass + */ + +import java.io.File; +import jdk.test.lib.compiler.InMemoryJavaCompiler; +import jdk.test.lib.process.OutputAnalyzer; + +public class SubClassOfPatchedClass { + private static String moduleJar; + private static String appJar; + + public static void main(String args[]) throws Throwable { + + // Create a class file in the module java.naming. This class file + // will be put in the javanaming.jar file. + String source = "package javax.naming; " + + "public class Reference { " + + " static { " + + " System.out.println(\"I pass!\"); " + + " } " + + "}"; + + String classDir = System.getProperty("test.classes"); + + ClassFileInstaller.writeClassToDisk("javax/naming/Reference", + InMemoryJavaCompiler.compile("javax.naming.Reference", source, "--patch-module=java.naming"), + classDir); + + // Build the jar file that will be used for the module "java.naming". + JarBuilder.build("javanaming", "javax/naming/Reference"); + moduleJar = TestCommon.getTestJar("javanaming.jar"); + + String source2 = "package mypackage; " + + "public class MyReference extends javax.naming.Reference { " + + " static { " + + " System.out.println(\"MyReference!\"); " + + " } " + + " public MyReference(String mystring) { " + + " super(mystring); " + + " } " + + "}"; + ClassFileInstaller.writeClassToDisk("mypackage/MyReference", + InMemoryJavaCompiler.compile("mypackage.MyReference", source2), + classDir); + + JarBuilder.build("myjavanaming", "mypackage/MyReference"); + appJar = TestCommon.getTestJar("myjavanaming.jar"); + + System.out.println("Test dumping with --patch-module"); + OutputAnalyzer output = + TestCommon.dump(appJar, + TestCommon.list("javax/naming/Reference", "mypackage/MyReference"), + "--patch-module=java.naming=" + moduleJar, + "-Xlog:class+load", + "PatchMain", "javax.naming.Reference", "mypackage.MyReference"); + TestCommon.checkDump(output, "Loading classes to share"); + + String classPath = appJar + File.pathSeparator + classDir; + System.out.println("classPath: " + classPath); + output = TestCommon.execCommon( + "-XX:+UnlockDiagnosticVMOptions", + "-cp", classPath, + "--patch-module=java.naming=" + moduleJar, + "-Xlog:class+load", + "PatchMain", "javax.naming.Reference", "mypackage.MyReference"); + TestCommon.checkExec(output, + "I pass!", + "MyReference source: file:"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/TwoJars.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/TwoJars.java new file mode 100644 index 00000000000..ef8b71a2165 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/TwoJars.java @@ -0,0 +1,100 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @summary a patched class found in --patch-module should be used at runtime + * @library ../.. + * @library /test/hotspot/jtreg/testlibrary + * @library /test/lib + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * @build PatchMain + * @run main TwoJars + */ + +import java.io.File; +import jdk.test.lib.compiler.InMemoryJavaCompiler; +import jdk.test.lib.process.OutputAnalyzer; + +public class TwoJars { + private static String moduleJar; + private static String moduleJar2; + + public static void main(String args[]) throws Throwable { + + // Create a class file in the module java.naming. This class file + // will be put in the javanaming.jar file. + String source = "package javax.naming.spi; " + + "public class NamingManager { " + + " static { " + + " System.out.println(\"I pass!\"); " + + " } " + + "}"; + + // Create a class file in the module java.naming. This class file + // will be put in the javanaming2.jar file. + String source2 = "package javax.naming.spi; " + + "public class DirectoryManager { " + + " static { " + + " System.out.println(\"I fail!\"); " + + " } " + + "}"; + + ClassFileInstaller.writeClassToDisk("javax/naming/spi/NamingManager", + InMemoryJavaCompiler.compile("javax.naming.spi.NamingManager", source, "--patch-module=java.naming"), + System.getProperty("test.classes")); + + // Build the jar file that will be used for the module "java.naming". + JarBuilder.build("javanaming", "javax/naming/spi/NamingManager"); + moduleJar = TestCommon.getTestJar("javanaming.jar"); + + ClassFileInstaller.writeClassToDisk("javax/naming/spi/DirectoryManager", + InMemoryJavaCompiler.compile("javax.naming.spi.DirectoryManager", source2, "--patch-module=java.naming"), + System.getProperty("test.classes")); + + // Build the jar file that will be used for the module "java.naming". + JarBuilder.build("javanaming2", "javax/naming/spi/DirectoryManager"); + moduleJar2 = TestCommon.getTestJar("javanaming2.jar"); + + System.out.println("Test dumping with --patch-module"); + OutputAnalyzer output = + TestCommon.dump(null, + TestCommon.list("javax/naming/spi/NamingManager"), + "--patch-module=java.naming=" + moduleJar2 + File.pathSeparator + moduleJar, + "-Xlog:class+load", + "-Xlog:class+path=info", + "PatchMain", "javax.naming.spi.NamingManager"); + TestCommon.checkDump(output, "Loading classes to share"); + + output = TestCommon.execCommon( + "-XX:+UnlockDiagnosticVMOptions", + "--patch-module=java.naming=" + moduleJar2 + File.pathSeparator + moduleJar, + "-Xlog:class+load", + "-Xlog:class+path=info", + "PatchMain", "javax.naming.spi.NamingManager"); + TestCommon.checkExec(output, "I pass"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/BootAppendTests.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/BootAppendTests.java new file mode 100644 index 00000000000..71392801fda --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/BootAppendTests.java @@ -0,0 +1,256 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/** + * @test + * @summary AppCDS tests for testing -Xbootclasspath/a + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * jdk.internal.jvmstat/sun.jvmstat.monitor + * @compile src/jdk/test/Main.java + * @compile src/com/sun/tools/javac/Main2.jasm + * @compile src/sun/nio/cs/ext/MyClass.java + * @compile src/sun/nio/cs/ext1/MyClass.java + * @run main BootAppendTests + */ + +import java.io.File; +import java.nio.file.Path; +import java.nio.file.Paths; +import jdk.test.lib.cds.CDSOptions; +import jdk.test.lib.cds.CDSTestUtils; +import jdk.test.lib.process.ProcessTools; +import jdk.test.lib.process.OutputAnalyzer; + +public class BootAppendTests { + private static final String TEST_SRC = System.getProperty("test.src"); + private static final Path SRC_DIR = Paths.get(TEST_SRC, "src"); + private static final Path CLASSES_DIR = Paths.get("classes"); + + private static final String MAIN_CLASS = "jdk.test.Main"; + private static final String APP_MODULE_CLASS = "com/sun/tools/javac/Main2"; + private static final String BOOT_APPEND_MODULE_CLASS = "sun/nio/cs/ext/MyClass"; + private static final String BOOT_APPEND_CLASS = "sun/nio/cs/ext1/MyClass"; + private static final String[] ARCHIVE_CLASSES = + {APP_MODULE_CLASS, BOOT_APPEND_MODULE_CLASS, BOOT_APPEND_CLASS}; + + private static String appJar; + private static String bootAppendJar; + private static String testArchiveName; + + public static void main(String... args) throws Exception { + dumpArchive(); + + System.out.println("TESTCASE: 1: testBootAppendModuleClassWithoutAppCDS"); + testBootAppendModuleClassWithoutAppCDS(); + + System.out.println("TESTCASE: 2" ); + testBootAppendModuleClassWithAppCDS(); + + System.out.println("TESTCASE: 3" ); + testBootAppendExcludedModuleClassWithoutAppCDS(); + + System.out.println("TESTCASE: 4" ); + testBootAppendExcludedModuleClassWithAppCDS(); + + System.out.println("TESTCASE: 5" ); + testBootAppendClassWithoutAppCDS(); + + System.out.println("TESTCASE: 6" ); + testBootAppendClassWithAppCDS(); + + System.out.println("TESTCASE: 7" ); + testBootAppendAppModuleClassWithoutAppCDS(); + + System.out.println("TESTCASE: 9" ); + testBootAppendAppModuleClassWithAppCDS(); + + System.out.println("TESTCASE: 9" ); + testBootAppendAppExcludeModuleClassWithoutAppCDS(); + + System.out.println("TESTCASE: 10" ); + testBootAppendAppExcludeModuleClassAppCDS(); + } + + static void dumpArchive() throws Exception { + JarBuilder.build("classpathtests", "jdk/test/Main"); + appJar = TestCommon.getTestJar("classpathtests.jar"); + + JarBuilder.build("bootAppend", + APP_MODULE_CLASS, BOOT_APPEND_MODULE_CLASS, BOOT_APPEND_CLASS); + bootAppendJar = TestCommon.getTestJar("bootAppend.jar"); + + OutputAnalyzer output1 = TestCommon.dump( + appJar, TestCommon.list(ARCHIVE_CLASSES), "-Xbootclasspath/a:" + bootAppendJar); + TestCommon.checkDump(output1); + + if (!TestCommon.isUnableToMap(output1)) { + // Make sure all the classes were successfully archived. + for (String archiveClass : ARCHIVE_CLASSES) { + output1.shouldNotContain("Preload Warning: Cannot find " + archiveClass); + } + } + + testArchiveName = TestCommon.getCurrentArchiveName(); + } + + // Test #1: A class in package defined in boot module + // - should not be loaded from the -Xbootclasspath/a without AppCDS + public static void testBootAppendModuleClassWithoutAppCDS() throws Exception { + CDSOptions opts = (new CDSOptions()) + .addPrefix("-Xbootclasspath/a:" + bootAppendJar, "-cp", appJar) + .setArchiveName(testArchiveName) + .addSuffix(MAIN_CLASS, "Test #1", BOOT_APPEND_MODULE_CLASS, "false"); + + CDSTestUtils.runWithArchiveAndCheck(opts); + } + + // Test #2: A shared class in package defined in boot module that's archived + // from -Xbootclasspath/a + // - should not be loaded by AppCDS + public static void testBootAppendModuleClassWithAppCDS() throws Exception { + OutputAnalyzer output = TestCommon.exec( + appJar, + "-Xbootclasspath/a:" + bootAppendJar, + MAIN_CLASS, + "Test #2", BOOT_APPEND_MODULE_CLASS, "false"); + TestCommon.checkExec(output); + } + + + // Test #3: A class in excluded package defined in boot module + // - should be loaded from the -Xbootclasspath/a by the boot classloader + public static void testBootAppendExcludedModuleClassWithoutAppCDS() throws Exception { + CDSOptions opts = (new CDSOptions()) + .addPrefix("-Xbootclasspath/a:" + bootAppendJar, "-cp", appJar, + "--limit-modules", "java.base") + .setArchiveName(testArchiveName) + .addSuffix(MAIN_CLASS, "Test #3", BOOT_APPEND_MODULE_CLASS, "true", "BOOT"); + + CDSTestUtils.runWithArchiveAndCheck(opts); + } + + // Test #4: A shared class in excluded package that's archived from + // -Xbootclasspath/a + // - should be loaded from the archive by the bootstrap classloader + public static void testBootAppendExcludedModuleClassWithAppCDS() throws Exception { + OutputAnalyzer output = TestCommon.exec( + appJar, + "-Xbootclasspath/a:" + bootAppendJar, + "--limit-modules", "java.base", + "-XX:+TraceClassLoading", + MAIN_CLASS, + "Test #4", BOOT_APPEND_MODULE_CLASS, "true", "BOOT"); + TestCommon.checkExec(output); + if (!TestCommon.isUnableToMap(output)) + output.shouldContain("[class,load] sun.nio.cs.ext.MyClass source: shared objects file"); + } + + + // Test #5: A class not in package defined in boot module + // - should be loaded from the -Xbootclasspath/a without AppCDS + public static void testBootAppendClassWithoutAppCDS() throws Exception { + CDSOptions opts = (new CDSOptions()) + .addPrefix("-Xbootclasspath/a:" + bootAppendJar, "-cp", appJar) + .setArchiveName(testArchiveName) + .addSuffix(MAIN_CLASS, "Test #5", BOOT_APPEND_CLASS, "true", "BOOT"); + + CDSTestUtils.runWithArchiveAndCheck(opts); + } + + + // Test #6: A shared class not in package defined in boot module that's + // archived from -Xbootclasspath/a + // - should be loaded from the archive by the bootstrap class loader + public static void testBootAppendClassWithAppCDS() throws Exception { + OutputAnalyzer output = TestCommon.exec( + appJar, + "-Xbootclasspath/a:" + bootAppendJar, + "-XX:+TraceClassLoading", + MAIN_CLASS, + "Test #6", BOOT_APPEND_CLASS, "true", "BOOT"); + TestCommon.checkExec(output); + if (!TestCommon.isUnableToMap(output)) + output.shouldContain("[class,load] sun.nio.cs.ext1.MyClass source: shared objects file"); + } + + + // Test #7: A class in package defined in jimage app module + // - should not be loaded from the -Xbootclasspath/a without AppCDS + public static void testBootAppendAppModuleClassWithoutAppCDS() throws Exception { + CDSOptions opts = (new CDSOptions()) + .addPrefix("-Xbootclasspath/a:" + bootAppendJar, "-cp", appJar) + .setArchiveName(testArchiveName) + .addSuffix(MAIN_CLASS, "Test #7", APP_MODULE_CLASS, "false"); + + CDSTestUtils.runWithArchiveAndCheck(opts); + } + + + // Test #8: A shared class in package defined in jimage app module that's + // archived from -Xbootclasspath/a + // - should not be loaded from the archive + public static void testBootAppendAppModuleClassWithAppCDS() throws Exception { + OutputAnalyzer output = TestCommon.exec( + appJar, + "-Xbootclasspath/a:" + bootAppendJar, + MAIN_CLASS, + "Test #8", APP_MODULE_CLASS, "false"); + TestCommon.checkExec(output); + } + + + // Test #9: A class in excluded package defined in jimage app module + // - should be loaded from the -Xbootclasspath/a without AppCDS + public static void testBootAppendAppExcludeModuleClassWithoutAppCDS() + throws Exception { + + CDSOptions opts = (new CDSOptions()) + .addPrefix("-Xbootclasspath/a:" + bootAppendJar, "-cp", appJar, + "--limit-modules", "java.base") + .setArchiveName(testArchiveName) + .addSuffix(MAIN_CLASS, "Test #9", APP_MODULE_CLASS, "true", "BOOT"); + + CDSTestUtils.runWithArchiveAndCheck(opts); + } + + // Test #10: A shared class in excluded package defined in jimage app module + // - should be loaded from the -Xbootclasspath/a with AppCDS + public static void testBootAppendAppExcludeModuleClassAppCDS() throws Exception { + OutputAnalyzer output = TestCommon.exec( + appJar, + "-Xbootclasspath/a:" + bootAppendJar, + "-XX:+TraceClassLoading", + "--limit-modules", "java.base", + MAIN_CLASS, + "Test #10", APP_MODULE_CLASS, "true", "BOOT"); + TestCommon.checkExec(output); + + if (!TestCommon.isUnableToMap(output)) + output.shouldContain("[class,load] com.sun.tools.javac.Main2 source: shared objects file"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/ClassPathTests.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/ClassPathTests.java new file mode 100644 index 00000000000..6f929ab227f --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/ClassPathTests.java @@ -0,0 +1,240 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/** + * @test + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library ../.. + * @library /test/lib + * @modules java.base/jdk.internal.misc + * @modules jdk.jartool/sun.tools.jar + * @compile src/jdk/test/Main.java + * @compile src/com/sun/tools/javac/Main.jasm + * @compile src/com/sun/tools/javac/Main2.jasm + * @compile src/javax/activation/UnsupportedDataTypeException2.jasm + * @run main ClassPathTests + * @summary AppCDS tests for testing classpath/package conflicts + */ + +/* + * These tests will verify that AppCDS will correctly handle archived classes + * on the classpath that are in a package that is also exported by the jimage. + * These classes should fail to load unless --limit-modules is used to hide the + * package exported by the jimage. There are 8 variants of this test: + * - With a jimage app package and with a jimage ext package + * - With --limit-modules and without --limit-modules + * - With AppCDS and without AppCDS (to verify behaviour is the same for both). + * + * There is also a 9th test to verify that when --limit-modules is used, a jimage + * class in the archive can be replaced by a classpath class with the + * same name and package. + */ + +import java.lang.reflect.Method; +import java.nio.file.Path; +import java.nio.file.Paths; + +import jdk.test.lib.Asserts; +import jdk.test.lib.cds.CDSOptions; +import jdk.test.lib.cds.CDSTestUtils; +import jdk.test.lib.process.ProcessTools; +import jdk.test.lib.process.OutputAnalyzer; + + +public class ClassPathTests { + private static final String TEST_SRC = System.getProperty("test.src"); + private static final Path SRC_DIR = Paths.get(TEST_SRC, "src"); + private static final Path CLASSES_DIR = Paths.get("classes"); + + // the test module + private static final String MAIN_CLASS = "jdk.test.Main"; + private static final String LIMITMODS_MAIN_CLASS = "jdk.test.LimitModsMain"; + + // test classes to archive. These are both in UPGRADED_MODULES + private static final String JIMAGE_CLASS = "com/sun/tools/javac/Main"; + private static final String APP_ARCHIVE_CLASS = "com/sun/tools/javac/Main2"; + private static final String PLATFORM_ARCHIVE_CLASS = "javax/activation/UnsupportedDataTypeException2"; + private static final String[] ARCHIVE_CLASSES = {APP_ARCHIVE_CLASS, PLATFORM_ARCHIVE_CLASS, JIMAGE_CLASS}; + private static final int NUMBER_OF_TEST_CASES = 10; + + private static String appJar; + private static String testArchiveName; + + + public static void main(String[] args) throws Exception { + ClassPathTests tests = new ClassPathTests(); + tests.dumpArchive(); + + Method[] methods = tests.getClass().getDeclaredMethods(); + int numOfTestMethodsRun = 0; + for (Method m : methods) { + if (m.getName().startsWith("test")) { + System.out.println("About to run test method: " + m.getName()); + m.invoke(tests); + numOfTestMethodsRun++; + } + } + + Asserts.assertTrue((numOfTestMethodsRun == NUMBER_OF_TEST_CASES), + "Expected " + NUMBER_OF_TEST_CASES + " test methods to run, actual number is " + + numOfTestMethodsRun); + } + + private void dumpArchive() throws Exception { + // Create a jar file with all the classes related to this test. + JarBuilder.build( "classpathtests", + APP_ARCHIVE_CLASS, PLATFORM_ARCHIVE_CLASS, JIMAGE_CLASS, + "jdk/test/Main"); + appJar = TestCommon.getTestJar("classpathtests.jar"); + + // dump the archive with altnernate jdk.comiler and jdk.activation classes in the class list + OutputAnalyzer output1 = TestCommon.dump(appJar, TestCommon.list(ARCHIVE_CLASSES)); + TestCommon.checkDump(output1); + // Only a class that belongs to a module which is not defined by default + // can be found. In this case the PLATFORM_ARCHIVE_CLASS belongs + // to the java.activation which is not defined by default; it is the only + // class can be found during dumping. + for (String archiveClass : ARCHIVE_CLASSES) { + if (archiveClass.equals(PLATFORM_ARCHIVE_CLASS)) { + output1.shouldNotContain("Preload Warning: Cannot find " + archiveClass); + } else { + output1.shouldContain("Preload Warning: Cannot find " + archiveClass); + } + } + + testArchiveName = TestCommon.getCurrentArchiveName(); + } + + // #1: Archived classpath class in same package as jimage app class. With AppCDS. + // Should fail to load. + public void testAppClassWithAppCDS() throws Exception { + OutputAnalyzer output = TestCommon.exec( + appJar, MAIN_CLASS, + "Test #1", APP_ARCHIVE_CLASS, "false"); // last 3 args passed to test + TestCommon.checkExec(output); + } + + // #2: Archived classpath class in same package as jimage app class. Without AppCDS. + // Should fail to load. + public void testAppClassWithoutAppCDS() throws Exception { + CDSOptions opts = (new CDSOptions()) + .addPrefix("-cp", appJar) + .setArchiveName(testArchiveName) + .addSuffix(MAIN_CLASS, "Test #2", APP_ARCHIVE_CLASS, "false"); + + CDSTestUtils.runWithArchiveAndCheck(opts); + } + + // For tests #3 and #4, we need to "--add-modules java.activation" since the + // java.activation module won't be defined by default. + + // #3: Archived classpath class in same package as jimage ext class. With AppCDS. + // Should fail to load. + public void testExtClassWithAppCDS() throws Exception { + OutputAnalyzer output = TestCommon.exec( + appJar, "--add-modules", "java.activation", MAIN_CLASS, + "Test #3", PLATFORM_ARCHIVE_CLASS, "false"); // last 3 args passed to test + TestCommon.checkExec(output); + } + + // #4: Archived classpath class in same package as jimage ext class. Without AppCDS. + // Should fail to load. + public void testExtClassWithoutAppCDS() throws Exception { + CDSOptions opts = (new CDSOptions()) + .addPrefix("-cp", appJar, "--add-modules", "java.activation") + .setArchiveName(testArchiveName) + .addSuffix(MAIN_CLASS, "Test #4", PLATFORM_ARCHIVE_CLASS, "false"); + + CDSTestUtils.runWithArchiveAndCheck(opts); + } + + // #5: Archived classpath class in same package as jimage app class. With AppCDS. + // Should load because --limit-modules is used. + public void testAppClassWithLimitModsWithAppCDS() throws Exception { + OutputAnalyzer output = TestCommon.exec( + appJar, + "--limit-modules", "java.base", + MAIN_CLASS, + "Test #5", APP_ARCHIVE_CLASS, "true"); // last 3 args passed to test + TestCommon.checkExec(output); + } + + // #6: Archived classpath class in same package as jimage app class. Without AppCDS. + // Should load because --limit-modules is used. + public void testAppClassWithLimitModsWithoutAppCDS() throws Exception { + CDSOptions opts = (new CDSOptions()) + .addPrefix("-cp", appJar, "--limit-modules", "java.base") + .setArchiveName(testArchiveName) + .addSuffix(MAIN_CLASS, "Test #6", APP_ARCHIVE_CLASS, "true"); + + CDSTestUtils.runWithArchiveAndCheck(opts); + } + + // #7: Archived classpath class in same package as jimage ext class. With AppCDS. + // Should load because --limit-modules is used. + public void testExtClassWithLimitModsWithAppCDS() throws Exception { + OutputAnalyzer output = TestCommon.exec( + appJar, + "--limit-modules", "java.base", + MAIN_CLASS, + "Test #7", PLATFORM_ARCHIVE_CLASS, "true"); // last 3 args passed to test + TestCommon.checkExec(output); + } + + // #8: Archived classpath class in same package as jimage ext class. Without AppCDS. + // Should load because --limit-modules is used. + public void testExtClassWithLimitModsWithoutAppCDS() throws Exception { + CDSOptions opts = (new CDSOptions()) + .addPrefix("-cp", appJar, "--limit-modules", "java.base") + .setArchiveName(testArchiveName) + .addSuffix(MAIN_CLASS, "Test #8", PLATFORM_ARCHIVE_CLASS, "true"); + + CDSTestUtils.runWithArchiveAndCheck(opts); + } + + // #9: Archived classpath class with same name as jimage app class. With AppCDS. + // Should load because --limit-modules is used. + public void testReplacingJImageClassWithAppCDS() throws Exception { + OutputAnalyzer output = TestCommon.exec( + appJar, + "--limit-modules", "java.base", "-XX:+TraceClassLoading", + MAIN_CLASS, + "Test #9", JIMAGE_CLASS, "true"); // last 3 args passed to test + TestCommon.checkExec(output); + } + + // #10: Archived classpath class with same name as jimage app class. Without AppCDS. + // Should load because --limit-modules is used. Note the archive will actually contain + // the original jimage version of the class, but AppCDS should refuse to load it + // since --limit-modules is used. This should result in the -cp version being used. + public void testReplacingJImageClassWithoutAppCDS() throws Exception { + CDSOptions opts = (new CDSOptions()) + .addPrefix("-cp", appJar, "--limit-modules", "java.base") + .setArchiveName(testArchiveName) + .addSuffix(MAIN_CLASS, "Test #10", JIMAGE_CLASS, "true"); + + CDSTestUtils.runWithArchiveAndCheck(opts); + } + +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/DummyClassesInBootClassPath.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/DummyClassesInBootClassPath.java new file mode 100644 index 00000000000..05311e818a1 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/DummyClassesInBootClassPath.java @@ -0,0 +1,88 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Ensure that classes found in jimage takes precedence over classes found in -Xbootclasspath/a. + * AppCDS does not support uncompressed oops + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.activation + * jdk.jartool/sun.tools.jar + * @compile ../../test-classes/DummyClassHelper.java + * @compile ../../test-classes/java/net/HttpCookie.jasm + * @compile ../../test-classes/javax/activation/MimeType.jasm + * @build sun.hotspot.WhiteBox + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @run main DummyClassesInBootClassPath + */ + +import java.io.File; +import java.util.List; +import java.util.ArrayList; +import jdk.test.lib.process.OutputAnalyzer; + +public class DummyClassesInBootClassPath { + private static final String METHOD_NAME = "thisClassIsDummy()"; + + public static void main(String[] args) throws Exception { + String classNames[] = { "java/net/HttpCookie", + "javax/activation/MimeType"}; + JarBuilder.build("dummyClasses", classNames[0], classNames[1]); + + String appJar = TestCommon.getTestJar("dummyClasses.jar"); + OutputAnalyzer dumpOutput = TestCommon.dump( + appJar, classNames, "-Xbootclasspath/a:" + appJar); + + List argsList = new ArrayList(); + for (int i = 0; i < classNames.length; i++) { + argsList.add(classNames[i].replace('/', '.')); + } + String[] arguments = new String[argsList.size()]; + arguments = argsList.toArray(arguments); + OutputAnalyzer execOutput = TestCommon.execCommon( + "-cp", TestCommon.getTestDir("."), "-verbose:class", + "--add-modules", "java.activation", + "-Xbootclasspath/a:" + appJar, "DummyClassHelper", + arguments[0], arguments[1]); + for (int i = 0; i < arguments.length; i++) { + TestCommon.checkExec(execOutput, + "java.lang.NoSuchMethodException: " + arguments[i] + "." + + METHOD_NAME); + } + + JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox"); + String whiteBoxJar = TestCommon.getTestJar("WhiteBox.jar"); + String bootClassPath = "-Xbootclasspath/a:" + appJar + + File.pathSeparator + whiteBoxJar; + argsList.add("testWithWhiteBox"); + arguments = new String[argsList.size()]; + arguments = argsList.toArray(arguments); + String[] opts = {"-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI", + bootClassPath, "-XX:+TraceClassPaths", "DummyClassHelper", + arguments[0], arguments[1], arguments[2]}; + OutputAnalyzer output = TestCommon.execCommon(opts); + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/EmptyClassInBootClassPath.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/EmptyClassInBootClassPath.java new file mode 100644 index 00000000000..a635603473e --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/EmptyClassInBootClassPath.java @@ -0,0 +1,106 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Test a few scenarios if an empty class, which has the same name as the one in the jimage, is specified in the -Xbootclasspath/a + * 1) boot loader will always load the class from the bootclasspath + * 2) app loader will load the class from the jimage by default; + * app loader will load the class from the bootclasspath if the + * "--limit-modules java.base" option is specified + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * jdk.internal.jvmstat/sun.jvmstat.monitor + * @compile ../../test-classes/EmptyClassHelper.java + * @compile ../../test-classes/com/sun/tools/javac/Main.jasm + * @run main EmptyClassInBootClassPath + */ + +import java.io.File; +import java.lang.*; +import java.lang.reflect.*; +import java.util.List; +import java.util.ArrayList; +import jdk.test.lib.process.OutputAnalyzer; + +public class EmptyClassInBootClassPath { + static final String EXPECTED_EXCEPTION = + "java.lang.NoSuchMethodException: com.sun.tools.javac.Main.main([Ljava.lang.String;)"; + public static void main(String[] args) throws Exception { + String[] className = {"com/sun/tools/javac/Main"}; + JarBuilder.build("emptyClass", className); + String appJar = TestCommon.getTestJar("emptyClass.jar"); + JarBuilder.build("EmptyClassHelper", "EmptyClassHelper"); + String helperJar = TestCommon.getTestJar("EmptyClassHelper.jar"); + OutputAnalyzer dumpOutput = TestCommon.dump( + appJar, className, "-Xbootclasspath/a:" + appJar); + TestCommon.checkDump(dumpOutput); + dumpOutput.shouldNotContain("Preload Warning: skipping class from -Xbootclasspath/a " + className[0]); + + String bootclasspath = "-Xbootclasspath/a:" + appJar; + String classPath = "-Djava.class.path=" + appJar + File.pathSeparator + helperJar; + List argsList = new ArrayList(); + argsList.add(classPath); + argsList.add(bootclasspath); + argsList.add("--add-exports=java.base/jdk.internal.misc=ALL-UNNAMED"); + argsList.add("EmptyClassHelper"); + + // case 1: load class in bootclasspath using app loader + argsList.add("useAppLoader"); + String[] opts = new String[argsList.size()]; + opts = argsList.toArray(opts); + OutputAnalyzer runOutput = TestCommon.execCommon(opts); + TestCommon.checkExec(runOutput, "appLoader found method main"); + + // case 2: load class in bootclasspath using boot loader + argsList.remove(argsList.size() - 1); + argsList.add("useBootLoader"); + opts = new String[argsList.size()]; + opts = argsList.toArray(opts); + runOutput = TestCommon.execCommon(opts); + TestCommon.checkExec(runOutput, EXPECTED_EXCEPTION); + + // case 3: load class in bootclasspath using app loader with '--limit-modules java.base' + argsList.add(0, "--limit-modules"); + argsList.add(1, "java.base"); + argsList.remove(argsList.size() - 1); + argsList.add("useAppLoader"); + opts = new String[argsList.size()]; + opts = argsList.toArray(opts); + runOutput = TestCommon.execCommon(opts); + TestCommon.checkExec(runOutput, EXPECTED_EXCEPTION); + + // case 4: load class in bootclasspath using boot loader with '--limit-modules java.base' + argsList.remove(argsList.size() - 1); + argsList.add("useBootLoader"); + opts = new String[argsList.size()]; + opts = argsList.toArray(opts); + runOutput = TestCommon.execCommon(opts); + TestCommon.checkExec(runOutput, EXPECTED_EXCEPTION); + + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/com/sun/tools/javac/Main.jasm b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/com/sun/tools/javac/Main.jasm new file mode 100644 index 00000000000..efe6c4a8e6e --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/com/sun/tools/javac/Main.jasm @@ -0,0 +1,46 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +package com/sun/tools/javac; + +public class Main + version 51:0 +{ + +public Method "":"()V" + stack 1 locals 1 +{ + aload_0; + invokespecial Method java/lang/Object."":"()V"; + return; +} + +public Method toString:"()Ljava/lang/String;" + stack 1 locals 1 +{ + ldc String "hi"; + areturn; +} + +} // end class Main diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/com/sun/tools/javac/Main2.jasm b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/com/sun/tools/javac/Main2.jasm new file mode 100644 index 00000000000..3d0f43256bf --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/com/sun/tools/javac/Main2.jasm @@ -0,0 +1,46 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +package com/sun/tools/javac; + +public class Main2 + version 51:0 +{ + +public Method "":"()V" + stack 1 locals 1 +{ + aload_0; + invokespecial Method java/lang/Object."":"()V"; + return; +} + +public Method toString:"()Ljava/lang/String;" + stack 1 locals 1 +{ + ldc String "hi"; + areturn; +} + +} // end class Main2 diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/javax/activation/UnsupportedDataTypeException2.jasm b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/javax/activation/UnsupportedDataTypeException2.jasm new file mode 100644 index 00000000000..3a30e511397 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/javax/activation/UnsupportedDataTypeException2.jasm @@ -0,0 +1,46 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +package javax/activation; + +public class UnsupportedDataTypeException2 + version 51:0 +{ + +public Method "":"()V" + stack 1 locals 1 +{ + aload_0; + invokespecial Method java/lang/Object."":"()V"; + return; +} + +public Method toString:"()Ljava/lang/String;" + stack 1 locals 1 +{ + ldc String "hi"; + areturn; +} + +} // end class UnsupportedDataTypeException2 diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/jdk/test/Main.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/jdk/test/Main.java new file mode 100644 index 00000000000..752fd9b7baf --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/jdk/test/Main.java @@ -0,0 +1,122 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/** + * Tests loading an archived class that has the same class name as one in the + * jimage. The class should normally fail to load since a classpath class is not + * allowed to have the same package name as a module in the jimage. However, + * if --limit-modules was used then archived class should be loaded. + */ + +package jdk.test; + +public class Main { + static final ClassLoader BOOT_LOADER = null; + static final ClassLoader PLATFORM_LOADER = ClassLoader.getPlatformClassLoader(); + static final ClassLoader SYS_LOADER = ClassLoader.getSystemClassLoader(); + + public static void main(String[] args) throws Exception { + boolean shouldLoad = false; + ClassLoader expectedLoader = SYS_LOADER; + + /* + * 3 Arguments are passed to this test: + * 1. testName: Name of the test being run. + * 2. className: Name of the class to load and instantiate. + * 3. shouldLoad: Either "true" or "false" to indicate whether the class should + * successfully load ("true" indicates --limit-modules was used.) + * The 4th argument is optional. It specifies the classloader. + */ + + assertTrue(args.length <= 4); + String testName = args[0]; + String className = args[1].replace('/', '.'); + String shouldLoadName = args[2]; // "true" or "false" + String loaderName = "SYS"; + if (args.length == 4) { + loaderName = args[3]; + } + + if (shouldLoadName.equals("true")) { + shouldLoad = true; + } else if (shouldLoadName.equals("false")) { + shouldLoad = false; + } else { + assertTrue(false); + } + + if (loaderName.equals("SYS")) { + expectedLoader = SYS_LOADER; + } else if (loaderName.equals("EXT")) { + expectedLoader = PLATFORM_LOADER; + } else if (loaderName.equals("BOOT")) { + expectedLoader = BOOT_LOADER; + } + + System.out.println(testName + ": class=" + className + " shouldLoad=" + + shouldLoadName + " by loader:" + expectedLoader); + + // Try to load the specified class with the default ClassLoader. + Class clazz = null; + try { + clazz = Class.forName(className); + } catch (ClassNotFoundException e) { + System.out.println(e); + } + + if (clazz != null) { + // class loaded + if (shouldLoad) { + // Make sure we got the expected defining ClassLoader + ClassLoader actualLoader = clazz.getClassLoader(); + if (actualLoader != expectedLoader) { + throw new RuntimeException(testName + " FAILED: " + clazz + " loaded by " + actualLoader + + ", expected " + expectedLoader); + } + // Make sure we got the right version of the class. toString() of an instance + // of the overridden version of the class should return "hi". + String s = clazz.newInstance().toString(); + if (!s.equals("hi")) { + throw new RuntimeException(testName + " FAILED: toString() returned \"" + s + + "\" instead of \"hi\"" ); + } + System.out.println(testName + " PASSED: class loaded as expected."); + } else { + throw new RuntimeException(testName + " FAILED: class loaded, but should have failed to load."); + } + } else { + // class did not load + if (shouldLoad) { + throw new RuntimeException(testName + " FAILED: class failed to load."); + } else { + System.out.println(testName + " PASSED: ClassNotFoundException thrown as expected"); + } + } + } + + static void assertTrue(boolean expr) { + if (!expr) + throw new RuntimeException("assertion failed"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/sun/nio/cs/ext/MyClass.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/sun/nio/cs/ext/MyClass.java new file mode 100644 index 00000000000..92e9204dce2 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/sun/nio/cs/ext/MyClass.java @@ -0,0 +1,31 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +package sun.nio.cs.ext; + +public class MyClass { + public String toString() { + return "hi"; + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/sun/nio/cs/ext1/MyClass.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/sun/nio/cs/ext1/MyClass.java new file mode 100644 index 00000000000..43b24f598ee --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/sun/nio/cs/ext1/MyClass.java @@ -0,0 +1,31 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +package sun.nio.cs.ext1; + +public class MyClass { + public String toString() { + return "hi"; + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/limitmods/LimitModsHelper.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/limitmods/LimitModsHelper.java new file mode 100644 index 00000000000..cb30412bae4 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/limitmods/LimitModsHelper.java @@ -0,0 +1,93 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/** + * Used with -p or --upgrade-module-path to exercise the replacement + * of classes in modules that are linked into the runtime image. + */ + +import java.lang.*; +import java.lang.reflect.*; +import sun.hotspot.WhiteBox; + + +public class LimitModsHelper { + static final ClassLoader PLATFORM_LOADER = ClassLoader.getPlatformClassLoader(); + static final ClassLoader SYS_LOADER = ClassLoader.getSystemClassLoader(); + + public static void main(String[] args) throws Exception { + assertTrue(args.length == 4); + String[] classNames = new String[3]; + for (int i = 0; i < 3; i++) { + classNames[i] = args[i].replace('/', '.'); + } + int excludeModIdx = Integer.parseInt(args[3]); + + ClassLoader expectedLoaders[] = {null, PLATFORM_LOADER, SYS_LOADER}; + + WhiteBox wb = WhiteBox.getWhiteBox(); + + Class clazz = null; + for (int i = 0; i < 3; i++) { + try { + // Load the class with the default ClassLoader. + clazz = Class.forName(classNames[i]); + } catch (Exception e) { + if (i == excludeModIdx) { + System.out.println(classNames[i] + " not found as expected because the module isn't in the --limit-modules - PASSED"); + } else { + throw(e); + } + } + + if (clazz != null && i != excludeModIdx) { + // Make sure we got the expected defining ClassLoader + testLoader(clazz, expectedLoaders[i]); + + // Make sure the class is in the shared space + if (!wb.isSharedClass(clazz)) { + throw new RuntimeException(clazz.getName() + + ".class should be in the shared space. " + + "loader=" + clazz.getClassLoader() + " module=" + clazz.getModule().getName()); + } + } + clazz = null; + } + } + + /** + * Asserts that given class has the expected defining loader. + */ + static void testLoader(Class clazz, ClassLoader expected) { + ClassLoader loader = clazz.getClassLoader(); + if (loader != expected) { + throw new RuntimeException(clazz + " loaded by " + loader + ", expected " + expected); + } + } + + static void assertTrue(boolean expr) { + if (!expr) + throw new RuntimeException("assertion failed"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/limitmods/LimitModsTests.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/limitmods/LimitModsTests.java new file mode 100644 index 00000000000..434ddfcfae6 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/limitmods/LimitModsTests.java @@ -0,0 +1,164 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/** + * @test + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library ../.. + * @library /test/lib + * @modules java.base/jdk.internal.misc + * @modules jdk.jartool/sun.tools.jar + * jdk.internal.jvmstat/sun.jvmstat.monitor + * @compile LimitModsHelper.java + * @compile ../../test-classes/java/net/HttpCookie.jasm + * @compile ../../test-classes/jdk/dynalink/DynamicLinker.jasm + * @compile ../../test-classes/com/sun/tools/javac/Main.jasm + * @build sun.hotspot.WhiteBox + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @run main LimitModsTests + * @summary AppCDS tests for excluding class in module by using --limit-modules. + */ + +/** + * This is for testing the --limit-modules option with AppCDS. + * This test assumes the following defining class loader, module, class relations: + * class loader module class + * ----------------------------------------------------- + * boot java.base java/net/HttpCookie + * platform jdk.dynalink jdk/dynalink/DynamicLinker + * app jdk.compiler com/sun/tools/javac/Main + * + * This test dumps the above 3 classes into a shared archive. + * Then it will run the following 4 -limit-modules scenarios: + * 1. without --limit-modules + * All 3 classes should be loaded successfully. + * All 3 classes should be loaded by the appropriate class loader. + * All 3 classes should be found in the shared archive. + * 2. --limit-modules java.base,jdk.dynalink + * The loading of the com/sun/tools/javac/Main class should fail. + * The other 2 classes should be loaded successfully and by the appropriate class loader. + * The other 2 classes should be found in the shared archive. + * 3. --limit-modules java.base,jdk.compiler + * The loading of the jdk/nio/dynalink/DynamicLinker class should fail. + * The other 2 classes should be loaded successfully and by the appropriate class loader. + * The other 2 classes should be found in the shared archive. + * 4. --limit-modules jdk.dynalink,jdk.compiler + * The java.base module can't be excluded. + * The results for this case is the same as for case #1. + */ + +import java.io.File; +import java.nio.file.Path; +import java.nio.file.Paths; + +import jdk.test.lib.process.ProcessTools; +import jdk.test.lib.process.OutputAnalyzer; + + +public class LimitModsTests { + + // the module that is limited + private static final String[] LIMIT_MODULES = {"java.base", "jdk.dynalink", "jdk.compiler"}; + + // test classes to archive. + private static final String BOOT_ARCHIVE_CLASS = "java/net/HttpCookie"; + private static final String PLATFORM_ARCHIVE_CLASS = "jdk/dynalink/DynamicLinker"; + private static final String APP_ARCHIVE_CLASS = "com/sun/tools/javac/Main"; + private static final String[] ARCHIVE_CLASSES = { + BOOT_ARCHIVE_CLASS, PLATFORM_ARCHIVE_CLASS, APP_ARCHIVE_CLASS}; + private String bootClassPath = null; + private String whiteBoxJar = null; + private String helperJar = null; + private String appJar = null; + private OutputAnalyzer output = null; + + public static void main(String[] args) throws Exception { + LimitModsTests tests = new LimitModsTests(); + tests.dumpArchive(); + tests.runTestNoLimitMods(); + tests.runTestLimitMods(); + } + + void dumpArchive() throws Exception { + JarBuilder.build("limitModsTest", BOOT_ARCHIVE_CLASS, PLATFORM_ARCHIVE_CLASS, APP_ARCHIVE_CLASS); + JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox"); + JarBuilder.build("limitModsHelper", "LimitModsHelper"); + + appJar = TestCommon.getTestJar("limitModsTest.jar"); + whiteBoxJar = TestCommon.getTestJar("WhiteBox.jar"); + helperJar = TestCommon.getTestJar("limitModsHelper.jar"); + bootClassPath = "-Xbootclasspath/a:" + whiteBoxJar; + // Dump the test classes into the archive + OutputAnalyzer output1 = TestCommon.dump(appJar, TestCommon.list(ARCHIVE_CLASSES), bootClassPath); + TestCommon.checkDump(output1); + // Make sure all the classes where successfully archived. + for (String archiveClass : ARCHIVE_CLASSES) { + output1.shouldNotContain("Preload Warning: Cannot find " + archiveClass); + } + } + + // run the test without --limit-modules + public void runTestNoLimitMods() throws Exception { + output = TestCommon.exec( + appJar + File.pathSeparator + helperJar, + "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI", bootClassPath, + "LimitModsHelper", + BOOT_ARCHIVE_CLASS, PLATFORM_ARCHIVE_CLASS, APP_ARCHIVE_CLASS, "-1"); // last 4 args passed to test + TestCommon.checkExec(output); + } + + // run the test with --limit-modules + // + // --limit-modules jdk.dynalink,jdk.compiler + // It seems we can't exclude the java.base module. For this case, + // although the java.base module isn't in --limit-modules, the class + // in the java.base module (java.net.HttpCookie) can also be found. + // + // --limit-modules java.base,jdk.dynalink + // --limit-modules java.base,jdk.compiler + public void runTestLimitMods() throws Exception { + String limitMods = null; + for (int excludeModIdx = 0; excludeModIdx < 3; excludeModIdx++) { + for (int includeModIdx = 0; includeModIdx < 3; includeModIdx++) { + if (includeModIdx != excludeModIdx) { + if (limitMods != null) { + limitMods += ","; + limitMods += LIMIT_MODULES[includeModIdx]; + } else { + limitMods = LIMIT_MODULES[includeModIdx]; + } + } + } + output = TestCommon.exec( + appJar + File.pathSeparator + helperJar, + "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI", bootClassPath, + "--limit-modules", limitMods, + "LimitModsHelper", + BOOT_ARCHIVE_CLASS, PLATFORM_ARCHIVE_CLASS, APP_ARCHIVE_CLASS, + Integer.toString(excludeModIdx)); // last 4 args passed to test + TestCommon.checkExec(output); + limitMods = null; + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/OverrideTests.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/OverrideTests.java new file mode 100644 index 00000000000..42355b73ec2 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/OverrideTests.java @@ -0,0 +1,238 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/** + * @test + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @modules java.base/jdk.internal.misc + * @library ../.. + * @library /test/lib + * @run main OverrideTests + * @summary AppCDS tests for overriding archived classes with -p and --upgrade-module-path + */ + +/* + * This test consists of 4 tests: + * 1. Archive PLATFORM class and override with --upgrade-module-path. + * 2. Archive PLATFORM class and override with -p. + * 3. Archive APP class and override with --upgrade-module-path. + * 4. Archive App class and override with -p. + * For all 4 tests, the class is instantiatied and toString() is called + * to check whether the archived version or the override version was instantiatied. + * For tests 1 and 3, the overridden version should be instantiatied. + * For tests 2 and 4, the archived version should be instantiated. + * + * This test uses the same test helper class in all 4 cases. It is located in + * src/test/jdk/test/Main.java. It will be invoked once for each test cases, + * with parameters to the test determining how it is run and what the + * expected result is. See Main.java for a description of these 3 arguments. + */ + +import java.io.File; +import java.nio.file.Files; +import java.nio.file.Path; +import java.nio.file.Paths; + +import jdk.test.lib.Asserts; +import jdk.test.lib.cds.CDSOptions; +import jdk.test.lib.cds.CDSTestUtils; +import jdk.test.lib.process.OutputAnalyzer; +import jdk.test.lib.process.ProcessTools; + + +public class OverrideTests { + private static final String TEST_SRC = System.getProperty("test.src"); + private static final Path SRC_DIR = Paths.get(TEST_SRC, "src"); + private static final Path MODS_DIR = Paths.get("mods"); + + // the module that is upgraded + private static final String[] UPGRADED_MODULES = {"jdk.compiler", "java.activation"}; + private static final Path[] UPGRADEDMODS_DIR = {Paths.get("upgradedmod1"), Paths.get("upgradedmod2")}; + + // the test module + private static final String TEST_MODULE = "test"; + private static final String MAIN_CLASS = "jdk.test.Main"; + + // test classes to archive. These are both in UPGRADED_MODULES + private static final String APP_ARCHIVE_CLASS = "com/sun/tools/javac/Main"; + private static final String PLATFORM_ARCHIVE_CLASS = "javax/activation/UnsupportedDataTypeException"; + private static final String[] ARCHIVE_CLASSES = {APP_ARCHIVE_CLASS, PLATFORM_ARCHIVE_CLASS}; + private static String testArchiveName; + + + public static void main(String[] args) throws Exception { + OverrideTests tests = new OverrideTests(); + tests.compileModulesAndDumpArchive(); + tests.testAppClassOverriding(); + tests.testPlatformClassOverriding(); + } + + void compileModulesAndDumpArchive() throws Exception { + boolean compiled; + // javac -d upgradedmods/$upgradedMod src/$upgradedMod/** + int i = 0; + for (String upgradedMod : UPGRADED_MODULES) { + compiled = CompilerUtils.compile( + SRC_DIR.resolve(upgradedMod), + UPGRADEDMODS_DIR[i].resolve(upgradedMod) + ); + Asserts.assertTrue(compiled, upgradedMod + " did not compile"); + i++; + } + + // javac -d mods/test --upgrade-module-path upgradedmods ... + compiled = CompilerUtils.compile( + SRC_DIR.resolve(TEST_MODULE), + MODS_DIR.resolve(TEST_MODULE), + "--upgrade-module-path", UPGRADEDMODS_DIR[0].toString() + + System.getProperty("path.separator") + UPGRADEDMODS_DIR[1].toString() + ); + Asserts.assertTrue(compiled, TEST_MODULE + " did not compile"); + + // the java.activation module is not defined by default; --add-modules is required. + // dumping without "--add-modules java.activation" + // the class in the javax.activation package cannot be found + OutputAnalyzer output1 = TestCommon.dump(null /* appJar*/, TestCommon.list(ARCHIVE_CLASSES)); + TestCommon.checkDump(output1); + output1.shouldContain( + "Preload Warning: Cannot find javax/activation/UnsupportedDataTypeException"); + + // dump the archive with jdk.comiler and java.activation classes in the class list + // with "--add-modules java.activation" + output1 = TestCommon.dump(null /* appJar*/, TestCommon.list(ARCHIVE_CLASSES), + "--add-modules", "java.activation"); + TestCommon.checkDump(output1); + // Make sure all the classes where successfully archived. + for (String archiveClass : ARCHIVE_CLASSES) { + output1.shouldNotContain("Preload Warning: Cannot find " + archiveClass); + } + + testArchiveName = TestCommon.getCurrentArchiveName(); + } + + /** + * APP Class Overriding Tests + * + * Archive APP class com.sun.tools.javac.Main from module jdk.compiler. + * -At run time, upgrade module jdk.compiler using --upgrade-module-path. + * Class.forname(Main) MUST NOT load the archived Main. + * -At run time, module jdk.compiler also exists in --module-path. + * Class.forname(Main) MUST load the archived Main. + */ + public void testAppClassOverriding() throws Exception { + testClassOverriding(APP_ARCHIVE_CLASS, "app"); + } + + /** + * PLATFORM Class Overriding Tests + * + * Archive PLATFORM class javax.activation.UnsupportedDataTypeException from module jdk.activation. + * -At run time, upgrade module jdk.activation using --upgrade-module-path. + * Class.forname(UnsupportedDataTypeException) MUST NOT load the archived UnsupportedDataTypeException. + * -At run time, module jdk.activation also exists in --module-path. + * Class.forname(UnsupportedDataTypeException) MUST load the archived UnsupportedDataTypeException. + */ + public void testPlatformClassOverriding() throws Exception { + testClassOverriding(PLATFORM_ARCHIVE_CLASS, "platform"); + } + + /** + * Run the test twice. Once with upgrade module on --upgrade-module-path and once with it on -p. + * Only modules defined to the PlatformClassLoader are upgradeable. + * Modules defined to the AppClassLoader are not upgradeble; we expect the + * FindException to be thrown. + */ + void testClassOverriding(String archiveClass, String loaderName) throws Exception { + String mid = TEST_MODULE + "/" + MAIN_CLASS; + OutputAnalyzer output; + boolean isAppLoader = loaderName.equals("app"); + int upgradeModIdx = isAppLoader ? 0 : 1; + String expectedException = "java.lang.module.FindException: Unable to compute the hash"; + String prefix[] = new String[4]; + prefix[0] = "-cp"; + prefix[1] = "\"\""; + prefix[2] = "--add-modules"; + prefix[3] = "java.activation"; + + // Run the test with --upgrade-module-path set to alternate location of archiveClass + // The alternate version of archiveClass SHOULD be found. + output = TestCommon.execModule( + prefix, + UPGRADEDMODS_DIR[upgradeModIdx].toString(), + MODS_DIR.toString(), + mid, + archiveClass, loaderName, "true"); // last 3 args passed to test + if (isAppLoader) { + try { + output.shouldContain(expectedException); + } catch (Exception e) { + TestCommon.checkCommonExecExceptions(output, e); + } + } else { + TestCommon.checkExec(output); + } + + // Now run this same test again, but this time without AppCDS. Behavior should be the same. + CDSOptions opts = (new CDSOptions()) + .addPrefix(prefix) + .setArchiveName(testArchiveName).setUseVersion(false) + .addSuffix("--upgrade-module-path", UPGRADEDMODS_DIR[upgradeModIdx].toString(), + "-p", MODS_DIR.toString(), "-m", mid) + .addSuffix(archiveClass, loaderName, "true"); + + output = CDSTestUtils.runWithArchive(opts); + + if (isAppLoader) { + try { + output.shouldContain(expectedException); + } catch (Exception e) { + TestCommon.checkCommonExecExceptions(output, e); + } + } else { + if (!CDSTestUtils.isUnableToMap(output)) + output.shouldHaveExitValue(0); + } + + // Run the test with -p set to alternate location of archiveClass. + // The alternate version of archiveClass SHOULD NOT be found. + output = TestCommon.execModule( + prefix, + null, + UPGRADEDMODS_DIR[upgradeModIdx].toString() + java.io.File.pathSeparator + MODS_DIR.toString(), + mid, + archiveClass, loaderName, "false"); // last 3 args passed to test + TestCommon.checkExec(output); + + // Now run this same test again, but this time without AppCDS. Behavior should be the same. + opts = (new CDSOptions()) + .addPrefix(prefix) + .setArchiveName(testArchiveName).setUseVersion(false) + .addSuffix("-p", MODS_DIR.toString(), "-m", mid) + .addSuffix(archiveClass, loaderName, "false"); // params to the test class + + OutputAnalyzer out = CDSTestUtils.runWithArchive(opts); + if (!CDSTestUtils.isUnableToMap(out)) + out.shouldHaveExitValue(0); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/java.activation/javax/activation/UnsupportedDataTypeException.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/java.activation/javax/activation/UnsupportedDataTypeException.java new file mode 100644 index 00000000000..3016bb41a10 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/java.activation/javax/activation/UnsupportedDataTypeException.java @@ -0,0 +1,36 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +package javax.activation; + +import java.io.IOException; + +public class UnsupportedDataTypeException extends IOException { + public UnsupportedDataTypeException() { + } + + public String toString() { + return "hi"; + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/java.activation/module-info.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/java.activation/module-info.java new file mode 100644 index 00000000000..23c707a46f7 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/java.activation/module-info.java @@ -0,0 +1,28 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +module java.activation { + exports javax.activation; +} + diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/jdk.compiler/com/sun/tools/javac/Main.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/jdk.compiler/com/sun/tools/javac/Main.java new file mode 100644 index 00000000000..f535ccd034a --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/jdk.compiler/com/sun/tools/javac/Main.java @@ -0,0 +1,31 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +package com.sun.tools.javac; + +public class Main { + public String toString() { + return "hi"; + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/jdk.compiler/module-info.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/jdk.compiler/module-info.java new file mode 100644 index 00000000000..a9c236d7bac --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/jdk.compiler/module-info.java @@ -0,0 +1,28 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +module jdk.compiler { + exports com.sun.tools.javac; +} + diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/test/jdk/test/Main.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/test/jdk/test/Main.java new file mode 100644 index 00000000000..e752f4d3da5 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/test/jdk/test/Main.java @@ -0,0 +1,101 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/** + * Used with -p or --upgrade-module-path to exercise the replacement + * of classes in modules that are linked into the runtime image. + */ + +package jdk.test; + +public class Main { + static final ClassLoader PLATFORM_LOADER = ClassLoader.getPlatformClassLoader(); + static final ClassLoader SYS_LOADER = ClassLoader.getSystemClassLoader(); + + public static void main(String[] args) throws Exception { + ClassLoader loader = null; + boolean shouldOverride = false; + + /* + * 3 Arguments are passed to this test: + * 1. className: Name of the class to load. + * 2. loaderName: Either "platform" or "app", which specifies which ClassLoader is expected + * to be the defining ClassLoader once the class is loaded. The initiating + * ClassLoader is always the default ClassLoader (which should be the + * app (system) ClassLoader. + * 3. shouldOverride: Either "true" or "false" to indicate whether the loaded class + * should be the one we are attempting to override with (not the archived version). + */ + + assertTrue(args.length == 3, "Unexpected number of arguments: expected 3, actual " + args.length); + String className = args[0].replace('/', '.'); + String loaderName = args[1]; // "platform" or "app" + String shouldOverrideName = args[2]; // "true" or "false" + + if (loaderName.equals("app")) { + loader = SYS_LOADER; + } else if (loaderName.equals("platform")) { + loader = PLATFORM_LOADER; + } else { + assertTrue(false); + } + + if (shouldOverrideName.equals("true")) { + shouldOverride = true; + } else if (shouldOverrideName.equals("false")) { + shouldOverride = false; + } else { + assertTrue(false); + } + + // Load the class with the default ClassLoader. + Class clazz = Class.forName(className, true, loader); + // Make sure we got the expected defining ClassLoader + testLoader(clazz, loader); + // Create an instance and see what toString() returns + String s = clazz.newInstance().toString(); + // The overridden version of the class should return "hi". Make sure + // it does only if we are expecting to have loaded the overridden version. + assertTrue(s.equals("hi") == shouldOverride); + } + + /** + * Asserts that given class has the expected defining loader. + */ + static void testLoader(Class clazz, ClassLoader expected) { + ClassLoader loader = clazz.getClassLoader(); + if (loader != expected) { + throw new RuntimeException(clazz + " loaded by " + loader + ", expected " + expected); + } + } + + static void assertTrue(boolean expr) { + assertTrue(expr, ""); + } + + static void assertTrue(boolean expr, String msg) { + if (!expr) + throw new RuntimeException("assertion failed: " + msg); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/test/module-info.java b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/test/module-info.java new file mode 100644 index 00000000000..8ca8942555b --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/test/module-info.java @@ -0,0 +1,28 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +module test { + requires jdk.compiler; + requires java.activation; +} diff --git a/test/hotspot/jtreg/runtime/appcds/jvmti/ClassFileLoadHook.java b/test/hotspot/jtreg/runtime/appcds/jvmti/ClassFileLoadHook.java new file mode 100644 index 00000000000..7d564caa8d1 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jvmti/ClassFileLoadHook.java @@ -0,0 +1,93 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +class LoadMe { + static String getValue() { + return "beforeHook"; + } + static String getOtherValue() { + return "abc-beforeHook-xyz"; + } +} + +public class ClassFileLoadHook { + public enum TestCaseId { + SHARING_OFF_CFLH_ON, // test case to establish a baseline + SHARING_ON_CFLH_OFF, + SHARING_AUTO_CFLH_ON, + SHARING_ON_CFLH_ON + } + + public static void main(String args[]) { + TestCaseId testCase = TestCaseId.valueOf(args[0]); + WhiteBox wb = WhiteBox.getWhiteBox(); + + System.out.println("====== ClassFileLoadHook.main():testCase = " + testCase); + System.out.println("getValue():" + LoadMe.getValue()); + System.out.println("getOtherValue():" + LoadMe.getOtherValue()); + + switch (testCase) { + case SHARING_OFF_CFLH_ON: + assertTrue("after_Hook".equals(LoadMe.getValue()) && + "abc-after_Hook-xyz".equals(LoadMe.getOtherValue()), + "Not sharing, this test should replace beforeHook " + + "with after_Hook"); + break; + + case SHARING_ON_CFLH_OFF: + assertTrue(wb.isSharedClass(LoadMe.class), + "LoadMe should be shared, but is not"); + assertTrue("beforeHook".equals(LoadMe.getValue()) && + "abc-beforeHook-xyz".equals(LoadMe.getOtherValue()), + "CFLH off, bug values are redefined"); + break; + + case SHARING_AUTO_CFLH_ON: + case SHARING_ON_CFLH_ON: + // LoadMe is rewritten on CFLH + assertFalse(wb.isSharedClass(LoadMe.class), + "LoadMe should not be shared if CFLH has modified the class"); + assertFalse("beforeHook".equals(LoadMe.getValue()) && + "abc-beforeHook-xyz".equals(LoadMe.getOtherValue()), + "Class contents should be changed if CFLH is enabled"); + break; + + default: + throw new RuntimeException("Invalid testcase"); + + } + } + + private static void assertTrue(boolean expr, String msg) { + if (!expr) + throw new RuntimeException(msg); + } + + private static void assertFalse(boolean expr, String msg) { + if (expr) + throw new RuntimeException(msg); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jvmti/ClassFileLoadHookTest.java b/test/hotspot/jtreg/runtime/appcds/jvmti/ClassFileLoadHookTest.java new file mode 100644 index 00000000000..e62013ba8a3 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jvmti/ClassFileLoadHookTest.java @@ -0,0 +1,100 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Test jvmti class file loader hook interaction with AppCDS + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * java.management + * @build ClassFileLoadHook + * @run main/othervm/native ClassFileLoadHookTest + */ + + +import jdk.test.lib.Asserts; +import jdk.test.lib.cds.CDSOptions; +import jdk.test.lib.process.OutputAnalyzer; +import jdk.test.lib.process.ProcessTools; + + +public class ClassFileLoadHookTest { + public static String sharedClasses[] = { + "ClassFileLoadHook", + "ClassFileLoadHook$TestCaseId", + "ClassFileLoadHook$1", + "LoadMe" + }; + + public static void main(String[] args) throws Exception { + String wbJar = + ClassFileInstaller.writeJar("WhiteBox.jar", "sun.hotspot.WhiteBox"); + String appJar = + ClassFileInstaller.writeJar("ClassFileLoadHook.jar", sharedClasses); + String useWb = "-Xbootclasspath/a:" + wbJar; + + // First, run the test class directly, w/o sharing, as a baseline reference + ProcessBuilder pb = ProcessTools.createJavaProcessBuilder( + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", + useWb, + "-agentlib:SimpleClassFileLoadHook=LoadMe,beforeHook,after_Hook", + "ClassFileLoadHook", + "" + ClassFileLoadHook.TestCaseId.SHARING_OFF_CFLH_ON); + TestCommon.executeAndLog(pb, "no-sharing").shouldHaveExitValue(0); + + // Run with AppCDS, but w/o CFLH - second baseline + TestCommon.testDump(appJar, sharedClasses, useWb); + OutputAnalyzer out = TestCommon.exec(appJar, + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", useWb, + "ClassFileLoadHook", + "" + ClassFileLoadHook.TestCaseId.SHARING_ON_CFLH_OFF); + + TestCommon.checkExec(out); + + + // Now, run with AppCDS with -Xshare:auto and CFLH + out = TestCommon.execAuto("-cp", appJar, + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", useWb, + "-agentlib:SimpleClassFileLoadHook=LoadMe,beforeHook,after_Hook", + "ClassFileLoadHook", + "" + ClassFileLoadHook.TestCaseId.SHARING_AUTO_CFLH_ON); + + CDSOptions opts = (new CDSOptions()).setXShareMode("auto"); + TestCommon.checkExec(out, opts); + + // Now, run with AppCDS -Xshare:on and CFLH + out = TestCommon.exec(appJar, + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", useWb, + "-agentlib:SimpleClassFileLoadHook=LoadMe,beforeHook,after_Hook", + "ClassFileLoadHook", + "" + ClassFileLoadHook.TestCaseId.SHARING_ON_CFLH_ON); + TestCommon.checkExec(out); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationAgent.mf b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationAgent.mf new file mode 100644 index 00000000000..58dcf797de6 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationAgent.mf @@ -0,0 +1,5 @@ +Manifest-Version: 1.0 +Premain-Class: InstrumentationRegisterClassFileTransformer +Agent-Class: InstrumentationRegisterClassFileTransformer +Can-Retransform-Classes: true +Can-Redefine-Classes: true diff --git a/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationApp.java b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationApp.java new file mode 100644 index 00000000000..1328f583031 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationApp.java @@ -0,0 +1,220 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.lang.instrument.ClassDefinition; +import java.lang.instrument.Instrumentation; +import java.lang.instrument.UnmodifiableClassException; +import java.net.URL; +import java.net.URLClassLoader; +import java.io.File; +import java.security.CodeSigner; +import java.security.CodeSource; +import java.security.ProtectionDomain; +import sun.hotspot.WhiteBox; + +public class InstrumentationApp { + static WhiteBox wb = WhiteBox.getWhiteBox(); + + public static final String COO_CLASS_NAME = "InstrumentationApp$Coo"; + + public static interface Intf { // Loaded from Boot class loader (-Xbootclasspath/a). + public String get(); + } + public static class Bar implements Intf { // Loaded from Boot class loader. + public String get() { + // The initial transform: + // change "buzz" -> "fuzz" + // The re-transform: + // change "buzz" -> "guzz" + return "buzz"; + } + } + public static class Foo implements Intf { // Loaded from AppClassLoader, or from a custom loader + public String get() { + // The initial transform: + // change "buzz" -> "fuzz" + // The re-transform: + // change "buzz" -> "guzz" + return "buzz"; + } + } + public static class Coo implements Intf { // Loaded from custom class loader. + public String get() { + // The initial transform: + // change "buzz" -> "fuzz" + // The re-transform: + // change "buzz" -> "guzz" + return "buzz"; + } + } + + // This class file should be archived if AppCDSv2 is enabled on this platform. See + // the comments around the call to TestCommon.dump in InstrumentationTest.java. + public static class ArchivedIfAppCDSv2Enabled {} + + public static boolean isAppCDSV2Enabled() { + return wb.isSharedClass(ArchivedIfAppCDSv2Enabled.class); + } + + public static class MyLoader extends URLClassLoader { + public MyLoader(URL[] urls, ClassLoader parent, File jar) { + super(urls, parent); + this.jar = jar; + } + File jar; + + @Override + protected Class loadClass(String name, boolean resolve) throws ClassNotFoundException { + synchronized (getClassLoadingLock(name)) { + // First, check if the class has already been loaded + Class clz = findLoadedClass(name); + if (clz != null) { + return clz; + } + + if (name.equals(COO_CLASS_NAME)) { + try { + byte[] buff = Util.getClassFileFromJar(jar, name); + return defineClass(name, buff, 0, buff.length); + } catch (Throwable t) { + t.printStackTrace(); + throw new RuntimeException("Unexpected", t); + } + } + } + return super.loadClass(name, resolve); + } + } + + static int numTests = 0; + static int failed = 0; + static boolean isAttachingAgent = false; + static Instrumentation instrumentation; + + public static void main(String args[]) throws Throwable { + System.out.println("INFO: AppCDSv1 " + (wb.isSharedClass(InstrumentationApp.class) ? "enabled" :"disabled")); + System.out.println("INFO: AppCDSv2 " + (isAppCDSV2Enabled() ? "enabled" : "disabled")); + + File bootJar = new File(args[0]); + File appJar = new File(args[1]); + File custJar = new File(args[2]); + String flagFile = args[3]; + waitAttach(flagFile); + + instrumentation = InstrumentationRegisterClassFileTransformer.getInstrumentation(); + System.out.println("INFO: instrumentation = " + instrumentation); + + testBootstrapCDS("Bootstrap Loader", bootJar); + testAppCDSv1("Application Loader", appJar); + + if (isAppCDSV2Enabled()) { + testAppCDSv2("Custom Loader (unregistered)", custJar); + } + + if (failed > 0) { + throw new RuntimeException("FINAL RESULT: " + failed + " out of " + numTests + " test case(s) have failed"); + } else { + System.out.println("FINAL RESULT: All " + numTests + " test case(s) have passed!"); + } + } + + static void waitAttach(String flagFile) throws Throwable { + if (!flagFile.equals("noattach")) { + File f = new File(flagFile); + long start = System.currentTimeMillis(); + while (f.exists()) { + long elapsed = System.currentTimeMillis() - start; + System.out.println(".... (" + elapsed + ") waiting for deletion of " + f); + Thread.sleep(1000); + } + System.out.println("Attach succeeded (child)"); + isAttachingAgent = true; + } + } + + static void testBootstrapCDS(String group, File jar) throws Throwable { + doTest(group, new Bar(), jar); + } + + static void testAppCDSv1(String group, File jar) throws Throwable { + doTest(group, new Foo(), jar); + } + + static void testAppCDSv2(String group, File jar) throws Throwable { + URL[] urls = new URL[] {jar.toURI().toURL()}; + MyLoader loader = new MyLoader(urls, InstrumentationApp.class.getClassLoader(), jar); + Class klass = loader.loadClass(COO_CLASS_NAME); + doTest(group, (Intf)klass.newInstance(), jar); + } + + static void doTest(String group, Intf object, File jar) throws Throwable { + Class klass = object.getClass(); + System.out.println(); + System.out.println("++++++++++++++++++++++++++"); + System.out.println("Test group: " + group); + System.out.println("Testing with classloader = " + klass.getClassLoader()); + System.out.println("Testing with class = " + klass); + System.out.println("++++++++++++++++++++++++++"); + + // Initial transform + String f = object.get(); + assertTrue(f.equals("fuzz"), "object.get(): Initial transform should give 'fuzz'", f); + + // Retransform + f = "(failed)"; + try { + instrumentation.retransformClasses(klass); + f = object.get(); + } catch (UnmodifiableClassException|UnsupportedOperationException e) { + e.printStackTrace(); + } + assertTrue(f.equals("guzz"), "object.get(): retransformation should give 'guzz'", f); + + // Redefine + byte[] buff = Util.getClassFileFromJar(jar, klass.getName()); + Util.replace(buff, "buzz", "huzz"); + f = "(failed)"; + try { + instrumentation.redefineClasses(new ClassDefinition(klass, buff)); + f = object.get(); + } catch (UnmodifiableClassException|UnsupportedOperationException e) { + e.printStackTrace(); + } + assertTrue(f.equals("quzz"), "object.get(): redefinition should give 'quzz'", f); + + System.out.println("++++++++++++++++++++++++++++++++++++++++++++++++ (done)\n\n"); + } + + private static void assertTrue(boolean expr, String msg, String string) { + numTests ++; + System.out.printf("Test case %2d ", numTests); + + if (expr) { + System.out.println("PASSED: " + msg + " and we got '" + string + "'"); + } else { + failed ++; + System.out.println("FAILED: " + msg + " but we got '" + string + "'"); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationClassFileTransformer.java b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationClassFileTransformer.java new file mode 100644 index 00000000000..64eabbaf003 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationClassFileTransformer.java @@ -0,0 +1,57 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.lang.instrument.ClassFileTransformer; +import java.lang.instrument.IllegalClassFormatException; +import java.security.ProtectionDomain; + +// Note: Util is from /test/hotspot/jtreg/runtime/appcds/test-classes/TestCommon.java + +public class InstrumentationClassFileTransformer implements ClassFileTransformer { + public byte[] transform(ClassLoader loader, String name, Class classBeingRedefined, + ProtectionDomain pd, byte[] buffer) throws IllegalClassFormatException { + + if (name.startsWith("InstrumentationApp$") && !name.equals("InstrumentationApp$NotTransformed")) { + System.out.println("Transforming: " + name + " class = " + classBeingRedefined); + try { + if (classBeingRedefined == null) { + // Initial transform + replace(buffer, "buzz", "fuzz"); + } else { + replace(buffer, "buzz", "guzz"); // Retransform + replace(buffer, "huzz", "quzz"); // Redefine + } + } catch (Throwable t) { + t.printStackTrace(); + } + return buffer; + } + return null; + } + + static void replace(byte[] buffer, String from, String to) { + int n = Util.replace(buffer, from, to); + System.out.println("..... replaced " + n + " occurrence(s) of '" + from + "' to '" + to + "'"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationRegisterClassFileTransformer.java b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationRegisterClassFileTransformer.java new file mode 100644 index 00000000000..2d2aec74269 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationRegisterClassFileTransformer.java @@ -0,0 +1,45 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.lang.instrument.ClassFileTransformer; +import java.lang.instrument.Instrumentation; + +// This class is available on the classpath so it can be accessed by InstrumentationApp +public class InstrumentationRegisterClassFileTransformer { + private static Instrumentation savedInstrumentation; + + public static void premain(String agentArguments, Instrumentation instrumentation) { + System.out.println("InstrumentationRegisterClassFileTransformer.premain() is called"); + instrumentation.addTransformer(new InstrumentationClassFileTransformer(), /*canRetransform=*/true); + savedInstrumentation = instrumentation; + } + + public static Instrumentation getInstrumentation() { + return savedInstrumentation; + } + + public static void agentmain(String args, Instrumentation inst) throws Exception { + premain(args, inst); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationTest.java b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationTest.java new file mode 100644 index 00000000000..1e869c28929 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationTest.java @@ -0,0 +1,278 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Exercise the java.lang.instrument.Instrumentation APIs on classes archived + * using CDS/AppCDSv1/AppCDSv2. + * @library /test/lib /test/hotspot/jtreg/runtime/appcds /test/hotspot/jtreg/runtime/appcds/test-classes + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.flavor != "minimal" + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * java.management + * @build sun.hotspot.WhiteBox + * InstrumentationApp + * InstrumentationClassFileTransformer + * InstrumentationRegisterClassFileTransformer + * @run main/othervm InstrumentationTest + */ + +// Note: TestCommon is from /test/hotspot/jtreg/runtime/appcds/TestCommon.java +// Note: Util is from /test/hotspot/jtreg/runtime/appcds/test-classes/TestCommon.java + +import com.sun.tools.attach.VirtualMachine; +import com.sun.tools.attach.VirtualMachineDescriptor; +import java.io.File; +import java.io.FileOutputStream; +import java.util.List; +import jdk.test.lib.Asserts; +import jdk.test.lib.cds.CDSOptions; +import jdk.test.lib.process.OutputAnalyzer; +import jdk.test.lib.process.ProcessTools; + +public class InstrumentationTest { + public static String bootClasses[] = { + "InstrumentationApp$Intf", + "InstrumentationApp$Bar", + "sun.hotspot.WhiteBox", + }; + public static String appClasses[] = { + "InstrumentationApp", + "InstrumentationApp$Foo", + "InstrumentationApp$MyLoader", + }; + public static String custClasses[] = { + "InstrumentationApp$Coo", + }; + public static String sharedClasses[] = TestCommon.concat(bootClasses, appClasses); + + public static String agentClasses[] = { + "InstrumentationClassFileTransformer", + "InstrumentationRegisterClassFileTransformer", + "Util", + }; + + public static void main(String[] args) throws Throwable { + runTest(false); + runTest(true); + } + + public static void runTest(boolean attachAgent) throws Throwable { + String bootJar = + ClassFileInstaller.writeJar("InstrumentationBoot.jar", bootClasses); + String appJar = + ClassFileInstaller.writeJar("InstrumentationApp.jar", + TestCommon.concat(appClasses, + "InstrumentationApp$ArchivedIfAppCDSv2Enabled")); + String custJar = + ClassFileInstaller.writeJar("InstrumentationCust.jar", custClasses); + String agentJar = + ClassFileInstaller.writeJar("InstrumentationAgent.jar", + ClassFileInstaller.Manifest.fromSourceFile("InstrumentationAgent.mf"), + agentClasses); + + String bootCP = "-Xbootclasspath/a:" + bootJar; + + System.out.println(""); + System.out.println("============================================================"); + System.out.println("CDS: NO, attachAgent: " + (attachAgent ? "YES" : "NO")); + System.out.println("============================================================"); + System.out.println(""); + + String agentCmdArg, flagFile; + if (attachAgent) { + // we will attach the agent, so don't specify -javaagent in the command line. We'll use + // something harmless like -showversion to make it easier to construct the command line + agentCmdArg = "-showversion"; + } else { + agentCmdArg = "-javaagent:" + agentJar; + } + + // First, run the test class directly, w/o sharing, as a baseline reference + flagFile = getFlagFile(attachAgent); + AgentAttachThread t = doAttach(attachAgent, flagFile, agentJar); + ProcessBuilder pb = ProcessTools.createJavaProcessBuilder( + bootCP, + "-cp", appJar, + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", + "-Xshare:off", + agentCmdArg, + "InstrumentationApp", bootJar, appJar, custJar, flagFile); + TestCommon.executeAndLog(pb, "no-sharing").shouldHaveExitValue(0); + checkAttach(t); + + // Dump the AppCDS archive. On some platforms AppCDSv2 may not be enabled, so we + // first try the v2 classlist, and if that fails, revert to the v1 classlist. + // Note that the InstrumentationApp$ArchivedIfAppCDSv2Enabled class is archived + // only if V2 is enabled. This is tested by InstrumentationApp.isAppCDSV2Enabled(). + String[] v2Classes = { + "InstrumentationApp$ArchivedIfAppCDSv2Enabled", + "java/lang/Object id: 0", + "InstrumentationApp$Intf id: 1", + "InstrumentationApp$Coo id: 2 super: 0 interfaces: 1 source: " + custJar, + }; + String[] sharedClassesWithV2 = TestCommon.concat(v2Classes, sharedClasses); + OutputAnalyzer out = TestCommon.dump(appJar, sharedClassesWithV2, bootCP); + if (out.getExitValue() != 0) { + System.out.println("Redumping with AppCDSv2 disabled"); + TestCommon.testDump(appJar, sharedClasses, bootCP); + } + + // Run with AppCDS. + System.out.println(""); + System.out.println("============================================================"); + System.out.println("CDS: YES, attachAgent: " + (attachAgent ? "YES" : "NO")); + System.out.println("============================================================"); + System.out.println(""); + + flagFile = getFlagFile(attachAgent); + t = doAttach(attachAgent, flagFile, agentJar); + out = TestCommon.execAuto("-cp", appJar, + bootCP, + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", + agentCmdArg, + "InstrumentationApp", bootJar, appJar, custJar, flagFile); + + CDSOptions opts = (new CDSOptions()).setXShareMode("auto"); + TestCommon.checkExec(out, opts); + checkAttach(t); + } + + static int flagFileSerial = 1; + static private String getFlagFile(boolean attachAgent) { + if (attachAgent) { + // Do not reuse the same file name as Windows may fail to + // delete the file. + return "attach.flag." + ProcessHandle.current().pid() + + "." + (flagFileSerial++) + "." + System.currentTimeMillis(); + } else { + return "noattach"; + } + } + + static AgentAttachThread doAttach(boolean attachAgent, String flagFile, String agentJar) throws Throwable { + if (!attachAgent) { + return null; + } + + // We use the flagFile to prevent the child process to make progress, until we have + // attached to it. + File f = new File(flagFile); + FileOutputStream o = new FileOutputStream(f); + o.write(1); + o.close(); + if (!f.exists()) { + throw new RuntimeException("Failed to create " + f); + } + + // At this point, the child process is not yet launched. Note that + // TestCommon.exec() and OutputAnalyzer.OutputAnalyzer() both block + // until the child process has finished. + // + // So, we will launch a AgentAttachThread which will poll the system + // until the child process is launched, and then do the attachment. + // The child process is uniquely identified by having flagFile in its + // command-line -- see AgentAttachThread.getPid(). + AgentAttachThread t = new AgentAttachThread(flagFile, agentJar); + t.start(); + return t; + } + + static void checkAttach(AgentAttachThread thread) throws Throwable { + if (thread != null) { + thread.check(); + } + } + + static class AgentAttachThread extends Thread { + String flagFile; + String agentJar; + volatile boolean succeeded; + + AgentAttachThread(String flagFile, String agentJar) { + this.flagFile = flagFile; + this.agentJar = agentJar; + this.succeeded = false; + } + + static String getPid(String flagFile) throws Throwable { + while (true) { + // Keep polling until the child process has been launched. If for some + // reason the child process fails to launch, this test will be terminated + // by JTREG's time-out mechanism. + Thread.sleep(100); + List vmds = VirtualMachine.list(); + for (VirtualMachineDescriptor vmd : vmds) { + if (vmd.displayName().contains(flagFile) && vmd.displayName().contains("InstrumentationApp")) { + // We use flagFile (which has the PID of this process) as a unique identifier + // to ident the child process, which we want to attach to. + System.out.println("Process found: " + vmd.id() + " " + vmd.displayName()); + return vmd.id(); + } + } + } + } + + public void run() { + try { + String pid = getPid(flagFile); + VirtualMachine vm = VirtualMachine.attach(pid); + System.out.println(agentJar); + vm.loadAgent(agentJar); + } catch (Throwable t) { + t.printStackTrace(); + throw new RuntimeException(t); + } + + // Delete the flagFile to indicate to the child process that we + // have attached to it, so it should proceed. + File f = new File(flagFile); + for (int i=0; i<5; i++) { + // The detele may fail on Windows if the child JVM is checking + // f.exists() at exactly the same time?? Let's do a little + // dance. + f.delete(); + try { + Thread.sleep(10); + } catch (Throwable t) {;} + } + if (f.exists()) { + throw new RuntimeException("Failed to delete " + f); + } + System.out.println("Attach succeeded (parent)"); + succeeded = true; + } + + void check() throws Throwable { + super.join(); + if (!succeeded) { + throw new RuntimeException("Attaching agent to child VM failed"); + } + } + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/jvmti/parallelLoad/ParallelClassesTransform.java b/test/hotspot/jtreg/runtime/appcds/jvmti/parallelLoad/ParallelClassesTransform.java new file mode 100644 index 00000000000..b7cfe22d5fc --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jvmti/parallelLoad/ParallelClassesTransform.java @@ -0,0 +1,70 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +class ParallelClassTr0 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr1 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr2 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr3 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr4 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr5 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr6 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr7 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr8 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr9 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr10 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr11 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr12 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr13 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr14 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr15 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr16 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr17 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr18 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr19 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr20 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr21 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr22 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr23 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr24 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr25 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr26 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr27 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr28 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr29 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr30 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr31 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr32 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr33 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr34 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr35 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr36 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr37 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr38 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } +class ParallelClassTr39 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; } + +class ParallelClassesTransform { + public static final int NUMBER_OF_CLASSES = 40; + public static final String BEFORE_PATTERN = "class-transform-check: this-should-be-transformed"; + public static final String AFTER_PATTERN = "class-transform-check: this-has-been--transformed"; +} diff --git a/test/hotspot/jtreg/runtime/appcds/jvmti/parallelLoad/ParallelLoadAndTransformTest.java b/test/hotspot/jtreg/runtime/appcds/jvmti/parallelLoad/ParallelLoadAndTransformTest.java new file mode 100644 index 00000000000..6356e2d4a6d --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jvmti/parallelLoad/ParallelLoadAndTransformTest.java @@ -0,0 +1,88 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Load app classes from CDS archive in parallel threads, + * use initial transformation (CFLH) + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * /test/hotspot/jtreg/runtime/appcds/test-classes /test/hotspot/jtreg/runtime/appcds/jvmti + * /test/hotspot/jtreg/testlibrary/jvmti + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @modules java.base/jdk.internal.misc + * java.management + * jdk.jartool/sun.tools.jar + * java.instrument + * @build TransformUtil TransformerAgent ParallelLoad + * @run main ParallelLoadAndTransformTest + */ +import java.util.List; +import java.util.stream.Collectors; +import java.util.stream.IntStream; + +public class ParallelLoadAndTransformTest { + + public static void main(String[] args) throws Exception { + String prop = "-Dappcds.parallel.transform.mode=cflh"; + String appJar = ClassFileInstaller.writeJar("parallel_load.jar", + getClassList(true)); + String agentJar = prepareAgent(); + + TestCommon.test(appJar, getClassList(false), + "-javaagent:" + agentJar + "=ParallelClassTr.*", + prop, "ParallelLoad"); + } + + + private static String[] getClassList(boolean includeWatchdog) { + List classList = + IntStream.range(0, ParallelClassesTransform.NUMBER_OF_CLASSES) + .mapToObj(i -> "ParallelClassTr" + i) + .collect(Collectors.toList()); + + classList.add("ParallelLoad"); + classList.add("ParallelLoadThread"); + if (includeWatchdog) + classList.add("ParallelLoadWatchdog"); + + return classList.toArray(new String[0]); + } + + + // Agent is the same for all test cases + private static String prepareAgent() throws Exception { + String agentClasses[] = { + "TransformerAgent", + "TransformerAgent$SimpleTransformer", + "TransformUtil" + }; + + String manifest = "../../../../testlibrary/jvmti/TransformerAgent.mf"; + + return ClassFileInstaller.writeJar("TransformerAgent.jar", + ClassFileInstaller.Manifest.fromSourceFile(manifest), + agentClasses); + } + +} diff --git a/test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformInterfaceImplementorAppCDS.java b/test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformInterfaceImplementorAppCDS.java new file mode 100644 index 00000000000..4addd099854 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformInterfaceImplementorAppCDS.java @@ -0,0 +1,43 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Exercise initial transformation (class file loader hook) + * with CDS/AppCDS with Interface/Implementor pair + * @library /test/lib /test/hotspot/jtreg/runtime/appcds /test/hotspot/jtreg/runtime/appcds/test-classes + * /test/hotspot/jtreg/runtime/appcds/jvmti /test/hotspot/jtreg/runtime/SharedArchiveFile/serviceability + * /test/hotspot/jtreg/runtime/SharedArchiveFile/serviceability/transformRelatedClasses + * /test/hotspot/jtreg/runtime/SharedArchiveFile /test/hotspot/jtreg/testlibrary/jvmti + * /test/hotspot/jtreg/runtime/appcds/customLoader + * /test/hotspot/jtreg/runtime/appcds/customLoader/test-classes + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.flavor != "minimal" + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * java.management + * java.instrument + * @build TransformUtil TransformerAgent Interface Implementor + * @run main/othervm TransformRelatedClassesAppCDS Interface Implementor + */ diff --git a/test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformRelatedClassesAppCDS.java b/test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformRelatedClassesAppCDS.java new file mode 100644 index 00000000000..1935715c09d --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformRelatedClassesAppCDS.java @@ -0,0 +1,204 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +// Structure of the test: +// TransformRelatedClassesAppCDS -- common main test driver +// Invoked from test driver classes: +// TransformInterfaceAndImplementor, TransformSuperAndSubClasses.java +// prepares test artifacts, launches tests, checks results +// SuperClazz, SubClass -- classes under test +// Interface, Implementor -- classes under test +// TransformerAgent -- an agent that is used when JVM-under-test is executed +// to transform specific strings inside specified classes +// TransformerAgent.mf - accompanies transformer agent +// CustomLoaderApp -- a test "application" that is used to load +// classes-under-test (Parent, Child) via custom class loader, using +// AppCDS-v2 mechanism (unregistered custom loaders, aka FP) +// This "app" is launched in a child process by this driver with sharing on. + +import java.io.File; +import java.util.ArrayList; +import jdk.test.lib.process.OutputAnalyzer; + +// This class is intended to test 2 parent-child relationships: +// 1. Base Class (parent) and Derived Class (child) +// 2. Interface (parent) and Implementor (child) +// Parameters to main(): parent, child + +public class TransformRelatedClassesAppCDS extends TransformRelatedClasses { + private static void log(String msg, Object... args) { + String msg0 = String.format(msg, args); + System.out.println("TransformRelatedClassesAppCDS: " + msg0); + } + + // Initial Test Matrix: + // (ParentTransformed = true/false, ChildTransformed = true/false) x + // (BootCDS - see open tests, AppCDS-v1, AppCDS-v2-unregistered) + // Total cases: 2 x 4 = 8 + public static void main(String args[]) throws Exception { + TransformRelatedClassesAppCDS test = + new TransformRelatedClassesAppCDS(args[0], args[1]); + + test.prepareAgent(agentClasses); + + // Test Table + // testCaseId | transformParent | tranformChild | isParentExpectedShared | isChildExpectedShared + ArrayList testTable = new ArrayList<>(); + + // base case - no tranformation - all expected to be shared + testTable.add(new TestEntry(0, false, false, true, true)); + + // transform parent only - both parent and child should not be shared + testTable.add(new TestEntry(1, true, false, false, false)); + + // transform parent and child - both parent and child should not be shared + testTable.add(new TestEntry(2, true, true, false, false)); + + // transform child only - parent should still be shared, but not child + testTable.add(new TestEntry(3, false, true, true, false)); + + // run the tests + test.runWithAppLoader(testTable); + test.runWithCustomLoader(testTable); + } + + + public TransformRelatedClassesAppCDS(String parent, String child) { + super(parent, child); + + // a trick to get it compiled by jtreg + CustomLoaderApp.ping(); + } + + + private void prepareAgent(String[] agentClasses) throws Exception { + String manifest = "../../../../testlibrary/jvmti/TransformerAgent.mf"; + agentJar = ClassFileInstaller.writeJar("TransformerAgent.jar", + ClassFileInstaller.Manifest.fromSourceFile(manifest), + agentClasses); + } + + + private void runWithAppLoader(ArrayList testTable) throws Exception { + String appJar = writeJar("app", testClasses); + + // create an archive + OutputAnalyzer out = TestCommon.dump(appJar, testClasses); + TestCommon.checkDump(out); + + // execute with archive + for (TestEntry entry : testTable) { + log("runTestWithAppLoader(): testCaseId = %d", entry.testCaseId); + String params = TransformTestCommon.getAgentParams(entry, parent, child); + String agentParam = String.format("-javaagent:%s=%s", agentJar, params); + out = TestCommon.execCommon("-Xlog:class+load=info", "-cp", appJar, + agentParam, child); + + TransformTestCommon.checkResults(entry, out, parent, child); + } + } + + + private String[] getCustomClassList(String loaderType, String customJar) { + String type = child + "-" + loaderType; + + switch (type) { + + case "SubClass-unregistered": + return new String[] { + "CustomLoaderApp", + "java/lang/Object id: 0", + parent + " id: 1 super: 0 source: " + customJar, + child + " id: 2 super: 1 source: " + customJar, + }; + + case "Implementor-unregistered": + return new String[] { + "CustomLoaderApp", + "java/lang/Object id: 0", + parent + " id: 1 super: 0 source: " + customJar, + child + " id: 2 super: 0 interfaces: 1 source: " + customJar, + }; + + default: + throw new IllegalArgumentException("getCustomClassList - wrong type: " + type); + } + } + + + private void runWithCustomLoader(ArrayList testTable) throws Exception { + if (!TestCommon.isCustomLoaderSupported()) { + log("custom loader not supported for this platform" + + " - skipping test case for custom loader"); + return; + } + + String appClasses[] = { + "CustomLoaderApp", + }; + + String customClasses[] = { parent, child }; + + // create jar files: appJar, customJar (for custom loaders to load classes from) + String appJar = writeJar("custldr-app", appClasses); + String customJar = writeJar("custldr-custom", customClasses); + + for (TestEntry entry : testTable) { + log("runTestWithCustomLoader(): testCaseId = %d", entry.testCaseId); + // unregistered (aka FP) case + String[] classList = getCustomClassList("unregistered",customJar); + execAndCheckWithCustomLoader(entry, "unregistered", classList, + appJar, agentJar, customJar); + } + } + + + private void + execAndCheckWithCustomLoader(TestEntry entry, String loaderType, + String[] classList, String appJar, + String agentJar, String customJar) + throws Exception { + + OutputAnalyzer out = TestCommon.dump(appJar, classList); + TestCommon.checkDump(out); + + String agentParam = "-javaagent:" + agentJar + "=" + + TransformTestCommon.getAgentParams(entry, parent, child); + + out = TestCommon.execCommon("-Xlog:class+load=info", + "-cp", appJar, + "--add-opens=java.base/java.security=ALL-UNNAMED", + agentParam, + "CustomLoaderApp", + customJar, loaderType, child); + TransformTestCommon.checkResults(entry, out, parent, child); + } + + + private String writeJar(String type, String[] classes) + throws Exception { + String jarName = String.format("%s-%s.jar", child, type); + return ClassFileInstaller.writeJar(jarName, classes); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformSuperSubAppCDS.java b/test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformSuperSubAppCDS.java new file mode 100644 index 00000000000..2c631b916e4 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformSuperSubAppCDS.java @@ -0,0 +1,43 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Exercise initial transformation (class file loader hook) + * with CDS/AppCDS with SubClass and SuperClass + * @library /test/lib /test/hotspot/jtreg/runtime/appcds /test/hotspot/jtreg/runtime/appcds/test-classes + * /test/hotspot/jtreg/runtime/appcds/jvmti /test/hotspot/jtreg/runtime/SharedArchiveFile/serviceability + * /test/hotspot/jtreg/runtime/SharedArchiveFile/serviceability/transformRelatedClasses + * /test/hotspot/jtreg/runtime/SharedArchiveFile /test/hotspot/jtreg/testlibrary/jvmti + * /test/hotspot/jtreg/runtime/appcds/customLoader + * /test/hotspot/jtreg/runtime/appcds/customLoader/test-classes + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.flavor != "minimal" + * @modules java.base/jdk.internal.misc + * jdk.jartool/sun.tools.jar + * java.management + * java.instrument + * @build TransformUtil TransformerAgent SubClass SuperClazz + * @run main/othervm TransformRelatedClassesAppCDS SuperClazz SubClass + */ diff --git a/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineBasic.java b/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineBasic.java new file mode 100644 index 00000000000..943a5257557 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineBasic.java @@ -0,0 +1,105 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +public class RedefineBasic { + + public static String newB = + " class RedefineBasic$B { " + + " public static void okToCallBeforeRedefine() { " + + " throw new RuntimeException(\"newB: okToCallBeforeRedefine is " + + " called after redefinition, test failed\"); }" + + " public static void okToCallAfterRedefine() { " + + " System.out.println(\"newB: okToCallAfterRedefine\"); } " + + " } "; + + + static class B { + public static void okToCallBeforeRedefine() { + System.out.println("okToCallBeforeRedefine"); + } + public static void okToCallAfterRedefine() { + throw new RuntimeException( + "okToCallAfterRedefine is called before redefinition, test failed"); + } + } + + static class SubclassOfB extends B { + public static void testAfterRedefine() { + B.okToCallAfterRedefine(); + } + } + + class Subclass2OfB extends B { + public void testAfterRedefine() { + super.okToCallAfterRedefine(); + } + } + + // verify that a given class is shared, report error if necessary + public static void + verifyClassIsShared(WhiteBox wb, Class c) throws Exception { + if (!wb.isSharedClass(c)) { + throw new RuntimeException( + "This class should be shared but isn't: " + c.getName()); + } else { + System.out.println("The class is shared as expected: " + + c.getName()); + } + } + + public static void main(String[] args) throws Exception { + WhiteBox wb = WhiteBox.getWhiteBox(); + + verifyClassIsShared(wb, RedefineBasic.class); + verifyClassIsShared(wb, B.class); + verifyClassIsShared(wb, SubclassOfB.class); + verifyClassIsShared(wb, Subclass2OfB.class); + + // (1) Test case: verify that original B works as expected + // and that redefined B is shared and works as expected, + // with new behavior + B.okToCallBeforeRedefine(); + RedefineClassHelper.redefineClass(B.class, newB); + verifyClassIsShared(wb, B.class); + B.okToCallAfterRedefine(); + + // Static subclass of the super: + // 1. Make sure it is still shared + // 2. and it calls the correct super (the redefined one) + verifyClassIsShared(wb, SubclassOfB.class); + SubclassOfB.testAfterRedefine(); + + // Same as above, but for non-static class + verifyClassIsShared(wb, Subclass2OfB.class); + RedefineBasic thisTest = new RedefineBasic(); + thisTest.testSubclass2OfB(); + } + + public void testSubclass2OfB() { + Subclass2OfB sub = new Subclass2OfB(); + sub.testAfterRedefine(); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineBasicTest.java b/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineBasicTest.java new file mode 100644 index 00000000000..396e2cba703 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineBasicTest.java @@ -0,0 +1,76 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Run /runtime/RedefineTests/RedefineRunningMethods in AppCDS mode to + * make sure class redefinition works with CDS. + * (Note: AppCDS does not support uncompressed oops) + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib /test/hotspot/jtreg/runtime/RedefineTests /test/hotspot/jtreg/runtime/appcds + * @modules java.compiler + * java.instrument + * jdk.jartool/sun.tools.jar + * java.base/jdk.internal.misc + * java.management + * @run main RedefineClassHelper + * @build sun.hotspot.WhiteBox RedefineBasic + * @run main RedefineBasicTest + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class RedefineBasicTest { + public static String sharedClasses[] = { + "RedefineBasic", + "RedefineBasic$B", + "RedefineBasic$SubclassOfB", + "RedefineBasic$Subclass2OfB", + "RedefineClassHelper", + "jdk/test/lib/compiler/InMemoryJavaCompiler", + "jdk/test/lib/compiler/InMemoryJavaCompiler$FileManagerWrapper", + "jdk/test/lib/compiler/InMemoryJavaCompiler$FileManagerWrapper$1", + "jdk/test/lib/compiler/InMemoryJavaCompiler$MemoryJavaFileObject" + }; + + public static void main(String[] args) throws Exception { + String wbJar = + ClassFileInstaller.writeJar("WhiteBox.jar", "sun.hotspot.WhiteBox"); + String appJar = + ClassFileInstaller.writeJar("RedefineBasic.jar", sharedClasses); + String useWb = "-Xbootclasspath/a:" + wbJar; + + OutputAnalyzer output; + TestCommon.testDump(appJar, sharedClasses, useWb); + + // redefineagent.jar is created by executing "@run main RedefineClassHelper" + // which should be called before executing RedefineBasicTest + output = TestCommon.exec(appJar, useWb, + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", + "-javaagent:redefineagent.jar", + "RedefineBasic"); + TestCommon.checkExec(output); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineRunningMethods_Shared.java b/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineRunningMethods_Shared.java new file mode 100644 index 00000000000..2c2782873a6 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineRunningMethods_Shared.java @@ -0,0 +1,82 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Run /runtime/RedefineTests/RedefineRunningMethods in AppCDS mode to + * make sure class redefinition works with CDS. + * (Note: AppCDS does not support uncompressed oops) + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @library /test/lib /test/hotspot/jtreg/runtime/RedefineTests /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * @modules java.compiler + * java.instrument + * jdk.jartool/sun.tools.jar + * @run main RedefineClassHelper + * @build sun.hotspot.WhiteBox RedefineRunningMethods_SharedHelper + * @run main RedefineRunningMethods_Shared + */ + +import jdk.test.lib.process.OutputAnalyzer; + +public class RedefineRunningMethods_Shared { + public static String shared_classes[] = { + "RedefineRunningMethods_Shared", + "RedefineRunningMethods_SharedHelper", + "RedefineRunningMethods", + "RedefineRunningMethods$1", + "RedefineRunningMethods$2", + "RedefineRunningMethods$3", + "RedefineRunningMethods$B", + "RedefineClassHelper", + "jdk/test/lib/compiler/InMemoryJavaCompiler", + "jdk/test/lib/compiler/InMemoryJavaCompiler$FileManagerWrapper", + "jdk/test/lib/compiler/InMemoryJavaCompiler$FileManagerWrapper$1", + "jdk/test/lib/compiler/InMemoryJavaCompiler$MemoryJavaFileObject" + }; + + public static void main(String[] args) throws Exception { + String wbJar = ClassFileInstaller.writeJar("WhiteBox.jar", "sun.hotspot.WhiteBox"); + String appJar = ClassFileInstaller.writeJar("RedefineRunningMethods_Shared.jar", shared_classes); + String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar; + + OutputAnalyzer output; + TestCommon.testDump(appJar, shared_classes, + // command-line arguments ... + use_whitebox_jar); + + // RedefineRunningMethods.java contained this: + // @run main/othervm -javaagent:redefineagent.jar -Xlog:redefine+class+iklass+add=trace,redefine+class+iklass+purge=trace RedefineRunningMethods + output = TestCommon.exec(appJar, + // command-line arguments ... + use_whitebox_jar, + "-XX:+UnlockDiagnosticVMOptions", + "-XX:+WhiteBoxAPI", + // These arguments are expected by RedefineRunningMethods + "-javaagent:redefineagent.jar", + "-Xlog:redefine+class+iklass+add=trace,redefine+class+iklass+purge=trace", + "RedefineRunningMethods_SharedHelper"); + TestCommon.checkExec(output); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineRunningMethods_SharedHelper.java b/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineRunningMethods_SharedHelper.java new file mode 100644 index 00000000000..ff1ffada27b --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineRunningMethods_SharedHelper.java @@ -0,0 +1,49 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +/** + * This class is executed by RedefineRunningMethods_Shared.java in + * a sub-process. + */ +public class RedefineRunningMethods_SharedHelper { + public static void main(String[] args) throws Exception { + // (1) Validate that all classes used by RedefineRunningMethods are all shared. + WhiteBox wb = WhiteBox.getWhiteBox(); + for (String name : RedefineRunningMethods_Shared.shared_classes) { + name = name.replace('/', '.'); + Class c = Class.forName(name); + if (!wb.isSharedClass(c)) { + throw new RuntimeException("Test set-up problem. " + + "This class should be shared but isn't: " + name); + } else { + System.out.println("The class is shared as expected: " + name); + } + } + + // (2) Run the class redefinition test. + RedefineRunningMethods.main(args); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/ExerciseGC.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/ExerciseGC.java new file mode 100644 index 00000000000..7d70f463b4e --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/ExerciseGC.java @@ -0,0 +1,49 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Exercise GC with shared strings + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.gc.G1 + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @library /test/hotspot/jtreg/runtime/appcds /test/lib + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @build HelloStringGC sun.hotspot.WhiteBox + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @run main ExerciseGC + */ +public class ExerciseGC { + public static void main(String[] args) throws Exception { + SharedStringsUtils.buildJarAndWhiteBox("HelloStringGC"); + + SharedStringsUtils.dumpWithWhiteBox(TestCommon.list("HelloStringGC"), + "SharedStringsBasic.txt"); + + SharedStringsUtils.runWithArchiveAndWhiteBox("HelloStringGC", + "-XX:+UnlockDiagnosticVMOptions", "-XX:+VerifyBeforeGC"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/ExtraSharedInput.txt b/test/hotspot/jtreg/runtime/appcds/sharedStrings/ExtraSharedInput.txt new file mode 100644 index 00000000000..5b9257d07e9 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/ExtraSharedInput.txt @@ -0,0 +1,7 @@ +VERSION: 1.0 +@SECTION: Symbol +0 -1: +41 -1: (Ljava/util/Set;Ljava/lang/Object;)V +11 -1: linkMethod +18 -1: type can't be null +20 -1: isAlphaNumericString diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/FlagCombo.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/FlagCombo.java new file mode 100644 index 00000000000..951f2ec6447 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/FlagCombo.java @@ -0,0 +1,58 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Test relevant combinations of command line flags with shared strings + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @requires (vm.gc=="null") + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @build HelloString + * @run main FlagCombo + */ + +import jdk.test.lib.BuildHelper; + +public class FlagCombo { + public static void main(String[] args) throws Exception { + SharedStringsUtils.buildJar("HelloString"); + + SharedStringsUtils.dump(TestCommon.list("HelloString"), + "SharedStringsBasic.txt"); + + SharedStringsUtils.runWithArchive("HelloString", "-XX:+UseG1GC"); + + if (BuildHelper.isCommercialBuild()) { + SharedStringsUtils.runWithArchiveAuto("HelloString", "-XX:+UnlockCommercialFeatures", + "-XX:StartFlightRecording=dumponexit=true"); + } + + SharedStringsUtils.runWithArchive("HelloString", "-XX:+UnlockDiagnosticVMOptions", + "-XX:NativeMemoryTracking=detail", "-XX:+PrintNMTStatistics"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloString.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloString.java new file mode 100644 index 00000000000..3c1cbbe4361 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloString.java @@ -0,0 +1,32 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class HelloString { + public static void main(String args[]) { + // Let's reference the string that is in the archive + // Make sure the string below is in the shared string data file (string list) + String testString = "shared_test_string_unique_14325"; + System.out.println("Hello String: " + testString); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloStringGC.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloStringGC.java new file mode 100644 index 00000000000..14732626348 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloStringGC.java @@ -0,0 +1,69 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +public class HelloStringGC { + public static String[] array01 = new String[1000]; + public static String[] array02 = new String[1000]; + + public static void main(String args[]) throws RuntimeException { + String testString1 = "shared_test_string_unique_14325"; + String testString2 = "test123"; + + WhiteBox wb = WhiteBox.getWhiteBox(); + if (!wb.isShared(testString1) && !wb.areSharedStringsIgnored()) { + throw new RuntimeException("testString1 is not shared"); + } + + for (int i=0; i<5; i++) { + allocSomeStrings(testString1, testString2); + array01 = null; + array02 = null; + System.gc(); + sleep(300); + array01 = new String[1000]; + array02 = new String[1000]; + } + + wb.fullGC(); + + System.out.println("HelloStringGC: PASS"); + } + + private static void allocSomeStrings(String s1, String s2) { + for (int i = 0; i < 1000; i ++) { + array01[i] = new String(s1); + array02[i] = new String(s2); + } + } + + private static void sleep(int ms) { + try { + Thread.sleep(ms); + } catch (InterruptedException e) { + } + } + +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloStringPlus.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloStringPlus.java new file mode 100644 index 00000000000..5129a10ba80 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloStringPlus.java @@ -0,0 +1,76 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +// A test class to be launched in AppCDS mode, has basic+ +// coverage of string operations + +import sun.hotspot.WhiteBox; + +public class HelloStringPlus { + public static void main(String args[]) { + // Let's reference the string that is in archive + String testString1 = "shared_test_string_unique_14325"; + System.out.println("Hello String: " + testString1); + + WhiteBox wb = WhiteBox.getWhiteBox(); + if (!wb.isShared(testString1) && !wb.areSharedStringsIgnored()) { + throw new RuntimeException("testString1 is not shared"); + } + + // Check other basic string operations + // Interning and equality + String[] testArray = new String[] {"shared_", "test_", "string_", "intern_", "12345"}; + String toBeInterned = ""; + + StringBuilder sb = new StringBuilder(); + for (String s : testArray) { + sb.append(s); + } + toBeInterned = sb.toString(); + + System.out.println("About to intern a string: " + toBeInterned); + toBeInterned.intern(); + + // check equality + if (testString1.equals(toBeInterned)) + throw new RuntimeException("Equality test 1 failed"); + + if (!testString1.equals("shared_test_string" + '_' + "unique_14325")) + throw new RuntimeException("Equality test 2 failed"); + + // Chech the hash code functionality; no special assertions, just make sure + // no crashe or exception occurs + System.out.println("testString1.hashCode() = " + testString1.hashCode()); + + // Check intern() method for "" string + String empty = ""; + String empty_interned = empty.intern(); + if (wb.isShared(empty)) { + throw new RuntimeException("Empty string should not be shared"); + } + if (empty_interned != empty) { + throw new RuntimeException("Different string is returned from intern() for empty string"); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/IncompatibleOptions.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/IncompatibleOptions.java new file mode 100644 index 00000000000..6e71c88dcea --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/IncompatibleOptions.java @@ -0,0 +1,145 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Test options that are incompatible with use of shared strings + * Also test mismatch in oops encoding between dump time and run time + * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires (vm.gc=="null") + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @build HelloString + * @run main IncompatibleOptions + */ + +import jdk.test.lib.Asserts; +import jdk.test.lib.process.OutputAnalyzer; + +public class IncompatibleOptions { + static final String COOPS_DUMP_WARNING = + "Cannot dump shared archive when UseCompressedOops or UseCompressedClassPointers is off"; + static final String COOPS_EXEC_WARNING = + "UseCompressedOops and UseCompressedClassPointers must be on for UseSharedSpaces"; + static final String GC_WARNING = + "Archived java heap is not supported"; + static final String OBJ_ALIGNMENT_MISMATCH = + "The shared archive file's ObjectAlignmentInBytes of .* does not equal the current ObjectAlignmentInBytes of"; + static final String COMPACT_STRING_MISMATCH = + "The shared archive file's CompactStrings setting .* does not equal the current CompactStrings setting"; + + static String appJar; + + public static void main(String[] args) throws Exception { + appJar = JarBuilder.build("IncompatibleOptions", "HelloString"); + + // Uncompressed OOPs + testDump(1, "-XX:+UseG1GC", "-XX:-UseCompressedOops", COOPS_DUMP_WARNING, true); + + // incompatible GCs + testDump(2, "-XX:+UseParallelGC", "", GC_WARNING, false); + testDump(3, "-XX:+UseSerialGC", "", GC_WARNING, false); + testDump(4, "-XX:+UseConcMarkSweepGC", "", GC_WARNING, false); + + // ======= archive with compressed oops, run w/o + testDump(5, "-XX:+UseG1GC", "-XX:+UseCompressedOops", null, false); + testExec(5, "-XX:+UseG1GC", "-XX:-UseCompressedOops", + COOPS_EXEC_WARNING, true); + + // NOTE: No warning is displayed, by design + // Still run, to ensure no crash or exception + testExec(6, "-XX:+UseParallelGC", "", "", false); + testExec(7, "-XX:+UseSerialGC", "", "", false); + testExec(8, "-XX:+UseConcMarkSweepGC", "", "", false); + + // Test various oops encodings, by varying ObjectAlignmentInBytes and heap sizes + testDump(9, "-XX:+UseG1GC", "-XX:ObjectAlignmentInBytes=8", null, false); + testExec(9, "-XX:+UseG1GC", "-XX:ObjectAlignmentInBytes=16", + OBJ_ALIGNMENT_MISMATCH, true); + + // See JDK-8081416 - Oops encoding mismatch with shared strings + // produces unclear or incorrect warning + // Correct the test case once the above is fixed + // @ignore JDK-8081416 - for tracking purposes + // for now, run test as is until the proper behavior is determined + testDump(10, "-XX:+UseG1GC", "-Xmx1g", null, false); + testExec(10, "-XX:+UseG1GC", "-Xmx32g", null, true); + + // CompactStrings must match between dump time and run time + testDump(11, "-XX:+UseG1GC", "-XX:-CompactStrings", null, false); + testExec(11, "-XX:+UseG1GC", "-XX:+CompactStrings", + COMPACT_STRING_MISMATCH, true); + testDump(12, "-XX:+UseG1GC", "-XX:+CompactStrings", null, false); + testExec(12, "-XX:+UseG1GC", "-XX:-CompactStrings", + COMPACT_STRING_MISMATCH, true); + } + + static void testDump(int testCaseNr, String collectorOption, String extraOption, + String expectedWarning, boolean expectedToFail) throws Exception { + + System.out.println("Testcase: " + testCaseNr); + OutputAnalyzer output = TestCommon.dump(appJar, TestCommon.list("Hello"), + "-XX:+UseCompressedOops", + collectorOption, + "-XX:SharedArchiveConfigFile=" + TestCommon.getSourceFile("SharedStringsBasic.txt"), + extraOption); + + if (expectedWarning != null) + output.shouldContain(expectedWarning); + + if (expectedToFail) { + Asserts.assertNE(output.getExitValue(), 0, + "JVM is expected to fail, but did not"); + } + } + + static void testExec(int testCaseNr, String collectorOption, String extraOption, + String expectedWarning, boolean expectedToFail) throws Exception { + + OutputAnalyzer output; + System.out.println("Testcase: " + testCaseNr); + + // needed, otherwise system considers empty extra option as a + // main class param, and fails with "Could not find or load main class" + if (!extraOption.isEmpty()) { + output = TestCommon.exec(appJar, "-XX:+UseCompressedOops", + collectorOption, extraOption, "HelloString"); + } else { + output = TestCommon.exec(appJar, "-XX:+UseCompressedOops", + collectorOption, "HelloString"); + } + + if (expectedWarning != null) + output.shouldMatch(expectedWarning); + + if (expectedToFail) + Asserts.assertNE(output.getExitValue(), 0); + else + SharedStringsUtils.checkExec(output); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/InternSharedString.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/InternSharedString.java new file mode 100644 index 00000000000..d64643257d0 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/InternSharedString.java @@ -0,0 +1,56 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Test shared strings together with string intern operation + * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.gc.G1 + * @library /test/hotspot/jtreg/runtime/appcds /test/lib + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @compile InternStringTest.java + * @build sun.hotspot.WhiteBox + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @run main InternSharedString + */ + +public class InternSharedString { + public static void main(String[] args) throws Exception { + SharedStringsUtils.buildJarAndWhiteBox("InternStringTest"); + + SharedStringsUtils.dumpWithWhiteBox(TestCommon.list("InternStringTest"), + "ExtraSharedInput.txt"); + + String[] extraMatches = new String[] { + InternStringTest.passed_output1, + InternStringTest.passed_output2, + InternStringTest.passed_output3 }; + + SharedStringsUtils.runWithArchiveAndWhiteBox(extraMatches, "InternStringTest"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/InternStringTest.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/InternStringTest.java new file mode 100644 index 00000000000..cc95cdf6cbe --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/InternStringTest.java @@ -0,0 +1,79 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +public class InternStringTest { + public static String passed_output1 = "Found shared string."; + public static String passed_output2 = "Shared strings are equal."; + public static String passed_output3 = "Found shared string containing latin1 supplement chars."; + public static String passed_output4 = "Found shared string containing non-western chars."; + public static final String latin1Sup = "XXXX \u00a3 YYYY"; // \u00a3 = The pound sign + public static final String nonWestern = "XXXX \u5678 YYYY"; // \u5678 = Unicode Han Character 'ton (metric or English)' + + public static void main(String[] args) throws Exception { + WhiteBox wb = WhiteBox.getWhiteBox(); + + // All string literals are shared. + String shared1 = "LiveOak"; + String interned1 = shared1.intern(); + if (wb.areSharedStringsIgnored() || wb.isShared(interned1)) { + System.out.println(passed_output1); + } else { + throw new RuntimeException("Failed: String is not shared."); + } + + // Test 2: shared_string1.intern() == shared_string2.intern() + String shared2 = "LiveOak"; + String interned2 = shared2.intern(); + if (interned1 == interned2) { + System.out.println(passed_output2); + } else { + throw new RuntimeException("Not equal!"); + } + + // Test 3: interned strings with a char in latin1 supplement block [\u0080-\u00ff] + { + String a = "X" + latin1Sup.substring(1); + String b = a.intern(); + + if (wb.areSharedStringsIgnored() || wb.isShared(b)) { + System.out.println(passed_output3); + } else { + throw new RuntimeException("Failed: expected shared string with latin1-supplement chars."); + } + } + + // Test 5: interned strings with non-western characters + { + String a = "X" + nonWestern.substring(1); + String b = a.intern(); + if (wb.areSharedStringsIgnored() || wb.isShared(b)) { + System.out.println(passed_output4); + } else { + throw new RuntimeException("Failed: expected shared string with non-western chars."); + } + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/InvalidFileFormat.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/InvalidFileFormat.java new file mode 100644 index 00000000000..b781f345eed --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/InvalidFileFormat.java @@ -0,0 +1,73 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Check most common errors in file format + * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.gc.G1 + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @build HelloString + * @run main InvalidFileFormat + */ + +import jdk.test.lib.process.OutputAnalyzer; +import java.io.File; + +// Checking most common error use cases +// This file is not an exhastive test of various shared data file corruption +// Note on usability intent: the shared data file is created and handled by +// the previledge person in the server environment. +public class InvalidFileFormat { + public static void main(String[] args) throws Exception { + SharedStringsUtils.buildJar("HelloString"); + + test("NonExistentFile.txt", "Unable to get hashtable dump file size"); + test("InvalidHeader.txt", "wrong version of hashtable dump file"); + test("InvalidVersion.txt", "wrong version of hashtable dump file"); + test("CorruptDataLine.txt", "Unknown data type. Corrupted at line 2"); + test("InvalidSymbol.txt", "Unexpected character. Corrupted at line 2"); + test("InvalidSymbolFormat.txt", "Unrecognized format. Corrupted at line 9"); + test("OverflowPrefix.txt", "Num overflow. Corrupted at line 4"); + test("UnrecognizedPrefix.txt", "Unrecognized format. Corrupted at line 5"); + test("TruncatedString.txt", "Truncated. Corrupted at line 3"); + } + + private static void + test(String dataFileName, String expectedWarning) throws Exception { + System.out.println("Filename for testcase: " + dataFileName); + + OutputAnalyzer out = SharedStringsUtils.dumpWithoutChecks(TestCommon.list("HelloString"), + "invalidFormat" + File.separator + dataFileName); + + if (!TestCommon.isUnableToMap(out)) + out.shouldContain(expectedWarning).shouldHaveExitValue(1); + } + +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/LargePages.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/LargePages.java new file mode 100644 index 00000000000..a234da4a9df --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/LargePages.java @@ -0,0 +1,53 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Basic shared string test with large pages + * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.gc.G1 + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @build HelloString + * @run main LargePages + */ +public class LargePages { + public static void main(String[] args) throws Exception { + SharedStringsUtils.buildJar("HelloString"); + + SharedStringsUtils.dump(TestCommon.list("HelloString"), + "SharedStringsBasic.txt", "-XX:+UseLargePages"); + SharedStringsUtils.runWithArchive("HelloString", "-XX:+UseLargePages"); + + SharedStringsUtils.dump(TestCommon.list("HelloString"), + "SharedStringsBasic.txt", + "-XX:+UseLargePages", "-XX:+UseLargePagesInMetaspace"); + SharedStringsUtils.runWithArchive("HelloString", + "-XX:+UseLargePages", "-XX:+UseLargePagesInMetaspace"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/LockSharedStrings.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/LockSharedStrings.java new file mode 100644 index 00000000000..921361ec96a --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/LockSharedStrings.java @@ -0,0 +1,57 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Test locking on shared strings + * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.gc.G1 + * @library /test/hotspot/jtreg/runtime/appcds /test/lib + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @compile LockStringTest.java LockStringValueTest.java + * @build sun.hotspot.WhiteBox + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @run main LockSharedStrings + */ + +public class LockSharedStrings { + public static void main(String[] args) throws Exception { + SharedStringsUtils.buildJarAndWhiteBox("LockStringTest", "LockStringValueTest"); + + SharedStringsUtils.dumpWithWhiteBox( + TestCommon.list("LockStringTest", "LockStringValueTest"), + "ExtraSharedInput.txt"); + + String[] extraMatch = new String[] {"LockStringTest: PASS"}; + SharedStringsUtils.runWithArchiveAndWhiteBox(extraMatch, "LockStringTest"); + + extraMatch = new String[] {"LockStringValueTest: PASS"}; + SharedStringsUtils.runWithArchiveAndWhiteBox(extraMatch, "LockStringValueTest", + "--add-opens=java.base/java.lang=ALL-UNNAMED"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/LockStringTest.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/LockStringTest.java new file mode 100644 index 00000000000..daecd0a93f8 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/LockStringTest.java @@ -0,0 +1,68 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +public class LockStringTest extends Thread { + static String lock = "StringLock"; + static boolean done = false; + + public static void main(String[] args) throws Exception { + WhiteBox wb = WhiteBox.getWhiteBox(); + if (wb.areSharedStringsIgnored()) { + System.out.println("The shared strings are ignored"); + System.out.println("LockStringTest: PASS"); + return; + } + + if (!wb.isShared(lock)) { + throw new RuntimeException("Failed: String is not shared."); + } + + new LockStringTest().start(); + + synchronized(lock) { + while (!done) { + lock.wait(); + } + } + System.gc(); + System.out.println("LockStringTest: PASS"); + } + + public void run() { + String shared = "LiveOak"; + synchronized (lock) { + for (int i = 0; i < 100; i++) { + new String(shared); + System.gc(); + try { + sleep(5); + } catch (InterruptedException e) {} + } + done = true; + lock.notify(); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/LockStringValueTest.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/LockStringValueTest.java new file mode 100644 index 00000000000..4d1e2c1a808 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/LockStringValueTest.java @@ -0,0 +1,61 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.lang.reflect.*; +import sun.hotspot.WhiteBox; + +/* + * Lock the 'value' field of a known shared string, java.lang.Object + */ +public class LockStringValueTest { + public static void main(String args[]) { + String s = "LiveOak"; + WhiteBox wb = WhiteBox.getWhiteBox(); + + if (wb.areSharedStringsIgnored()) { + System.out.println("The shared strings are ignored"); + System.out.println("LockStringValueTest: PASS"); + return; + } + + if (!wb.isShared(s)) { + throw new RuntimeException("LockStringValueTest Failed: String is not shared."); + } + + Class c = s.getClass(); + try { + Field f = c.getDeclaredField("value"); + f.setAccessible(true); + Object v = f.get(s); + lock(v); + } catch (NoSuchFieldException nfe) { + } catch (IllegalAccessException iae) {} + } + + public static void lock(Object o) { + synchronized (o) { + System.out.println("LockStringValueTest: PASS"); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasic.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasic.java new file mode 100644 index 00000000000..7d9623aa4b7 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasic.java @@ -0,0 +1,78 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Basic test for shared strings + * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.gc.G1 + * @library /test/hotspot/jtreg/runtime/appcds /test/lib + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @build HelloString + * @run main SharedStringsBasic + */ +import jdk.test.lib.process.OutputAnalyzer; +import jdk.test.lib.process.ProcessTools; + +// This test does not use SharedStringsUtils intentionally: +// - in order to demonstrate the basic use of the functionality +// - to provide sanity check and catch potential problems in the utils +public class SharedStringsBasic { + public static void main(String[] args) throws Exception { + String appJar = JarBuilder.build("SharedStringsBasic", "HelloString"); + + String sharedArchiveConfigFile = + TestCommon.getSourceFile("SharedStringsBasic.txt").toString(); + + ProcessBuilder dumpPb = ProcessTools.createJavaProcessBuilder(true, + "-XX:+UseAppCDS", + "-XX:+UseCompressedOops", + "-XX:+UseG1GC", + "-cp", appJar, + "-XX:SharedArchiveConfigFile=" + sharedArchiveConfigFile, + "-XX:SharedArchiveFile=./SharedStringsBasic.jsa", + "-Xshare:dump", + "-Xlog:cds,cds+hashtables"); + + TestCommon.executeAndLog(dumpPb, "dump") + .shouldContain("Shared string table stats") + .shouldHaveExitValue(0); + + ProcessBuilder runPb = ProcessTools.createJavaProcessBuilder(true, + "-XX:+UseAppCDS", + "-XX:+UseCompressedOops", + "-XX:+UseG1GC", + "-cp", appJar, + "-XX:SharedArchiveFile=./SharedStringsBasic.jsa", + "-Xshare:auto", + "-showversion", + "HelloString"); + + TestCommon.executeAndLog(runPb, "run").shouldHaveExitValue(0); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasic.txt b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasic.txt new file mode 100644 index 00000000000..a43dabaaea9 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasic.txt @@ -0,0 +1,60 @@ +VERSION: 1.0 +@SECTION: String +0: +5: cp819 +31: shared_test_string_unique_14325 +31: shared_test_string_intern_12345 +7: test123 +1: * +1: - +1: . +1: / +1: : +1: C +1: I +1: J +1: U +1: Z +1: _ +8: segments +1: | +5: cp850 +5: cp852 +5: cp855 +5: cp857 +5: cp858 +5: cp862 +5: cp866 +11: ISO_8859_13 +11: ISO_8859_15 +5: cp874 +47: java.lang.invoke.MethodHandle.TRACE_INTERPRETER +7: CHECKED +3: zip +10: waitStatus +33: java.lang.invoke.MethodHandleImpl +7: .jimage +5: cp912 +5: cp914 +5: cp915 +5: cp920 +5: cp923 +5: cp936 +5: euccn +5: eucjp +11: permissions +5: euckr +6: SIGNAL +5: cp737 +17: java.library.path +5: cp775 +13: classValueMap +4: utf8 +9: PROPAGATE +9: baseCount +7: cskoi8r +8: cyrillic +@SECTION: Symbol +41 -1: (Ljava/util/Set;Ljava/lang/Object;)V +10 -1: linkMethod +20 -1: isAlphaNumericString diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasicPlus.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasicPlus.java new file mode 100644 index 00000000000..93209142709 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasicPlus.java @@ -0,0 +1,50 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Basic plus test for shared strings + * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.gc.G1 + * @library /test/hotspot/jtreg/runtime/appcds /test/lib + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @build HelloStringPlus sun.hotspot.WhiteBox + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @run main SharedStringsBasicPlus + */ + +public class SharedStringsBasicPlus { + public static void main(String[] args) throws Exception { + SharedStringsUtils.buildJarAndWhiteBox("HelloStringPlus"); + + SharedStringsUtils.dumpWithWhiteBox( TestCommon.list("HelloStringPlus"), + "SharedStringsBasic.txt"); + + SharedStringsUtils.runWithArchiveAndWhiteBox("HelloStringPlus"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsStress.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsStress.java new file mode 100644 index 00000000000..db531617a88 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsStress.java @@ -0,0 +1,71 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Write a lots of shared strings. + * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.gc.G1 + * @library /test/hotspot/jtreg/runtime/appcds /test/lib + * @modules jdk.jartool/sun.tools.jar + * @build HelloString + * @run main SharedStringsStress + */ +import java.io.File; +import java.io.FileOutputStream; +import java.io.OutputStreamWriter; +import java.io.PrintWriter; +import jdk.test.lib.process.OutputAnalyzer; +import jdk.test.lib.process.ProcessTools; + +public class SharedStringsStress { + public static void main(String[] args) throws Exception { + String appJar = JarBuilder.build("SharedStringsStress", "HelloString"); + + String sharedArchiveConfigFile = System.getProperty("user.dir") + File.separator + "SharedStringsStress_gen.txt"; + try (FileOutputStream fos = new FileOutputStream(sharedArchiveConfigFile)) { + PrintWriter out = new PrintWriter(new OutputStreamWriter(fos)); + out.println("VERSION: 1.0"); + out.println("@SECTION: String"); + out.println("31: shared_test_string_unique_14325"); + for (int i=0; i<100000; i++) { + String s = "generated_string " + i; + out.println(s.length() + ": " + s); + } + out.close(); + } + + // Set NewSize to 8m due to dumping could fail in hs-tier6 testing with + // the vm options: -XX:+UnlockCommercialFeatures -XX:+UseDeterministicG1GC + // resulting in vm initialization error: + // "GC triggered before VM initialization completed. Try increasing NewSize, current value 1331K." + OutputAnalyzer dumpOutput = TestCommon.dump(appJar, TestCommon.list("HelloString"), "-XX:NewSize=8m", + "-XX:SharedArchiveConfigFile=" + sharedArchiveConfigFile); + TestCommon.checkDump(dumpOutput); + OutputAnalyzer execOutput = TestCommon.exec(appJar, "HelloString"); + TestCommon.checkExec(execOutput); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsUtils.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsUtils.java new file mode 100644 index 00000000000..5121ae5924e --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsUtils.java @@ -0,0 +1,143 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import jdk.test.lib.cds.CDSOptions; +import jdk.test.lib.process.OutputAnalyzer; + +// A helper/utility class for testing shared strings +public class SharedStringsUtils { + public static final String TEST_JAR_NAME = "test"; + public static final String TEST_JAR_NAME_FULL = "test.jar"; + public static final String WHITEBOX_JAR_NAME = "whitebox"; + + public static String getWbParam() { + return "-Xbootclasspath/a:" + TestCommon.getTestJar(WHITEBOX_JAR_NAME + ".jar"); + } + + // build the test jar + public static void buildJar(String... classes) throws Exception { + JarBuilder.build(TEST_JAR_NAME, classes); + } + + // build the test jar and a whitebox jar + public static void buildJarAndWhiteBox(String... classes) throws Exception { + JarBuilder.build(true, WHITEBOX_JAR_NAME, "sun/hotspot/WhiteBox"); + buildJar(classes); + } + + // execute the "dump" operation, but do not check the output + public static OutputAnalyzer dumpWithoutChecks(String appClasses[], + String sharedDataFile, String... extraOptions) throws Exception { + + String appJar = TestCommon.getTestJar(TEST_JAR_NAME_FULL); + String[] args = + TestCommon.concat(extraOptions, "-XX:+UseCompressedOops", "-XX:+UseG1GC", + "-XX:SharedArchiveConfigFile=" + + TestCommon.getSourceFile(sharedDataFile)); + + return TestCommon.dump(appJar, appClasses, args); + } + + // execute the dump operation and check the output + public static OutputAnalyzer dump(String appClasses[], + String sharedDataFile, String... extraOptions) throws Exception { + OutputAnalyzer output = dumpWithoutChecks(appClasses, sharedDataFile, extraOptions); + checkDump(output); + return output; + } + + public static OutputAnalyzer dumpWithWhiteBox(String appClasses[], + String sharedDataFile, String... extraOptions) throws Exception { + return dump(appClasses, sharedDataFile, + TestCommon.concat(extraOptions, getWbParam()) ); + } + + // execute/run test with shared archive + public static OutputAnalyzer runWithArchiveAuto(String className, + String... extraOptions) throws Exception { + + String appJar = TestCommon.getTestJar(TEST_JAR_NAME_FULL); + String[] args = TestCommon.concat(extraOptions, + "-cp", appJar, "-XX:+UseCompressedOops", "-XX:+UseG1GC", className); + + OutputAnalyzer output = TestCommon.execAuto(args); + checkExecAuto(output); + return output; + } + + public static OutputAnalyzer runWithArchive(String className, + String... extraOptions) throws Exception { + + return runWithArchive(new String[0], className, extraOptions); + } + + public static OutputAnalyzer runWithArchive(String[] extraMatches, + String className, String... extraOptions) throws Exception { + + String appJar = TestCommon.getTestJar(TEST_JAR_NAME_FULL); + String[] args = TestCommon.concat(extraOptions, + "-XX:+UseCompressedOops", "-XX:+UseG1GC", className); + + OutputAnalyzer output = TestCommon.exec(appJar, args); + checkExec(output, extraMatches); + return output; + } + + + // execute/run test with shared archive and white box + public static OutputAnalyzer runWithArchiveAndWhiteBox(String className, + String... extraOptions) throws Exception { + + return runWithArchive(className, + TestCommon.concat(extraOptions, getWbParam(), + "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI") ); + } + + public static OutputAnalyzer runWithArchiveAndWhiteBox(String[] extraMatches, + String className, String... extraOptions) throws Exception { + + return runWithArchive(extraMatches, className, + TestCommon.concat(extraOptions, getWbParam(), + "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI") ); + } + + + public static void checkDump(OutputAnalyzer output) throws Exception { + output.shouldContain("Shared string table stats"); + TestCommon.checkDump(output); + } + + public static void checkExec(OutputAnalyzer output) throws Exception { + TestCommon.checkExec(output, new String[0]); + } + + public static void checkExecAuto(OutputAnalyzer output) throws Exception { + CDSOptions opts = (new CDSOptions()).setXShareMode("auto"); + TestCommon.checkExec(output, opts); + } + + public static void checkExec(OutputAnalyzer output, String[] extraMatches) throws Exception { + TestCommon.checkExec(output, extraMatches); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsWb.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsWb.java new file mode 100644 index 00000000000..3bd8eeb6152 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsWb.java @@ -0,0 +1,40 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +public class SharedStringsWb { + public static void main(String[] args) throws Exception { + WhiteBox wb = WhiteBox.getWhiteBox(); + String s = "shared_test_string_unique_14325"; + s = s.intern(); + if (wb.areSharedStringsIgnored() || wb.isShared(s)) { + System.out.println("Found shared string."); + } else { + throw new RuntimeException("String is not shared."); + } + } +} + + diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsWbTest.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsWbTest.java new file mode 100644 index 00000000000..fe3f05350a7 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsWbTest.java @@ -0,0 +1,53 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary White box test for shared strings + * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows + * @requires (sun.arch.data.model != "32") & (os.family != "windows") + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.gc.G1 + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * @modules java.management + * jdk.jartool/sun.tools.jar + * @build sun.hotspot.WhiteBox SharedStringsWb + * @run main ClassFileInstaller sun.hotspot.WhiteBox + * @run main SharedStringsWbTest + */ + +import java.io.*; +import sun.hotspot.WhiteBox; + +public class SharedStringsWbTest { + public static void main(String[] args) throws Exception { + SharedStringsUtils.buildJarAndWhiteBox("SharedStringsWb"); + + SharedStringsUtils.dumpWithWhiteBox(TestCommon.list("SharedStringsWb"), + "SharedStringsBasic.txt"); + + SharedStringsUtils.runWithArchiveAndWhiteBox("SharedStringsWb"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/SysDictCrash.java b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SysDictCrash.java new file mode 100644 index 00000000000..c96a75da7e1 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SysDictCrash.java @@ -0,0 +1,63 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* + * @test + * @summary Regression test for JDK-8098821 + * @bug 8098821 + * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true) + * @requires vm.gc.G1 + * @library /test/lib /test/hotspot/jtreg/runtime/appcds + * @modules java.base/jdk.internal.misc + * @modules java.management + * @run main SysDictCrash + */ + +import jdk.test.lib.process.OutputAnalyzer; +import jdk.test.lib.process.ProcessTools; + +public class SysDictCrash { + public static void main(String[] args) throws Exception { + // SharedBaseAddress=0 puts the archive at a very high address on solaris, + // which provokes the crash. + ProcessBuilder dumpPb = ProcessTools.createJavaProcessBuilder(true, + "-XX:+UseG1GC", "-XX:MaxRAMPercentage=12.5", + "-XX:+UseAppCDS", + "-cp", ".", + "-XX:SharedBaseAddress=0", "-XX:SharedArchiveFile=./SysDictCrash.jsa", + "-Xshare:dump", + "-showversion", "-Xlog:cds,cds+hashtables"); + + TestCommon.checkDump(TestCommon.executeAndLog(dumpPb, "dump")); + + ProcessBuilder runPb = ProcessTools.createJavaProcessBuilder(true, + "-XX:+UseG1GC", "-XX:MaxRAMPercentage=12.5", + "-XX:+UseAppCDS", + "-XX:SharedArchiveFile=./SysDictCrash.jsa", + "-Xshare:on", + "-version"); + + TestCommon.checkExec(TestCommon.executeAndLog(runPb, "exec")); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/CorruptDataLine.txt b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/CorruptDataLine.txt new file mode 100644 index 00000000000..fe5fb328c1e --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/CorruptDataLine.txt @@ -0,0 +1,60 @@ +VERSION: 1.0 +SECTION: String +0: +5: cp819 +31: shared_test_string_unique_14325 +31: shared_test_string_intern_12345 +7: test123 +1: * +1: - +1: . +1: / +1: : +1: C +1: I +1: J +1: U +1: Z +1: _ +8: segments +1: | +5: cp850 +5: cp852 +5: cp855 +5: cp857 +5: cp858 +5: cp862 +5: cp866 +11: ISO_8859_13 +11: ISO_8859_15 +5: cp874 +47: java.lang.invoke.MethodHandle.TRACE_INTERPRETER +7: CHECKED +3: zip +10: waitStatus +33: java.lang.invoke.MethodHandleImpl +7: .jimage +5: cp912 +5: cp914 +5: cp915 +5: cp920 +5: cp923 +5: cp936 +5: euccn +5: eucjp +11: permissions +5: euckr +6: SIGNAL +5: cp737 +17: java.library.path +5: cp775 +13: classValueMap +4: utf8 +9: PROPAGATE +9: baseCount +7: cskoi8r +8: cyrillic +#DATATYPE: Symbol +41 -1: (Ljava/util/Set;Ljava/lang/Object;)V +10 -1: linkMethod +20 -1: isAlphaNumericString diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidDataType.txt b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidDataType.txt new file mode 100644 index 00000000000..d19db9e4999 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidDataType.txt @@ -0,0 +1,60 @@ +VERSION: 1.0 +@SECTION: String +0: +5: cp819 +31: shared_test_string_unique_14325 +31: shared_test_string_intern_12345 +7: test123 +1: * +1: - +1: . +1: / +1: : +1: C +1: I +1: J +1: U +1: Z +1: _ +8: segments +1: | +5: cp850 +5: cp852 +5: cp855 +5: cp857 +5: cp858 +5: cp862 +5: cp866 +11: ISO_8859_13 +11: ISO_8859_15 +5: cp874 +47: java.lang.invoke.MethodHandle.TRACE_INTERPRETER +7: CHECKED +3: zip +10: waitStatus +33: java.lang.invoke.MethodHandleImpl +7: .jimage +5: cp912 +5: cp914 +5: cp915 +5: cp920 +5: cp923 +5: cp936 +5: euccn +5: eucjp +11: permissions +5: euckr +6: SIGNAL +5: cp737 +17: java.library.path +5: cp775 +13: classValueMap +4: utf8 +9: PROPAGATE +9: baseCount +7: cskoi8r +8: cyrillic +#DATATYPE: Symbol +41 -1: (Ljava/util/Set;Ljava/lang/Object;)V +10 -1: linkMethod +20 -1: isAlphaNumericString diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidHeader.txt b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidHeader.txt new file mode 100644 index 00000000000..02ff35b7246 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidHeader.txt @@ -0,0 +1,60 @@ +Garbage Header x0935#%0sl +@SECTION: String +0: +5: cp819 +31: shared_test_string_unique_14325 +31: shared_test_string_intern_12345 +7: test123 +1: * +1: - +1: . +1: / +1: : +1: C +1: I +1: J +1: U +1: Z +1: _ +8: segments +1: | +5: cp850 +5: cp852 +5: cp855 +5: cp857 +5: cp858 +5: cp862 +5: cp866 +11: ISO_8859_13 +11: ISO_8859_15 +5: cp874 +47: java.lang.invoke.MethodHandle.TRACE_INTERPRETER +7: CHECKED +3: zip +10: waitStatus +33: java.lang.invoke.MethodHandleImpl +7: .jimage +5: cp912 +5: cp914 +5: cp915 +5: cp920 +5: cp923 +5: cp936 +5: euccn +5: eucjp +11: permissions +5: euckr +6: SIGNAL +5: cp737 +17: java.library.path +5: cp775 +13: classValueMap +4: utf8 +9: PROPAGATE +9: baseCount +7: cskoi8r +8: cyrillic +#DATATYPE: Symbol +41 -1: (Ljava/util/Set;Ljava/lang/Object;)V +10 -1: linkMethod +20 -1: isAlphaNumericString diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidString.txt b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidString.txt new file mode 100644 index 00000000000..104785cc934 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidString.txt @@ -0,0 +1,6 @@ +VERSION: 1.0 +@SECTION: String +31: shred_test_string_unique_14325 +31: shared_test_string_intern_12345 +7: test123 + diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidStringFormat.txt b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidStringFormat.txt new file mode 100644 index 00000000000..bf4fe475ad7 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidStringFormat.txt @@ -0,0 +1,60 @@ +VERSION: 1.0 +@SECTION: String +0: +5:: cp819 +31: shared_test_string_unique_14325 +31: shared_test_string_intern_12345 +7: test123 +1: * +1: - +1: . +1: / +1: : +1: C +1: I +1: J +1: U +1: Z +1: _ +8: segments +1: | +5: cp850 +5: cp852 +5: cp855 +5: cp857 +5: cp858 +5: cp862 +5: cp866 +11: ISO_8859_13 +11: ISO_8859_15 +5: cp874 +47: java.lang.invoke.MethodHandle.TRACE_INTERPRETER +7: CHECKED +3: zip +10: waitStatus +33: java.lang.invoke.MethodHandleImpl +7: .jimage +5: cp912 +5: cp914 +5: cp915 +5: cp920 +5: cp923 +5: cp936 +5: euccn +5: eucjp +11: permissions +5: euckr +6: SIGNAL +5: cp737 +17: java.library.path +5: cp775 +13: classValueMap +4: utf8 +9: PROPAGATE +9: baseCount +7: cskoi8r +8: cyrillic +#DATATYPE: Symbol +41 -1: (Ljava/util/Set;Ljava/lang/Object;)V +10 -1: linkMethod +20 -1: isAlphaNumericString diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidSymbol.txt b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidSymbol.txt new file mode 100644 index 00000000000..7da06b825eb --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidSymbol.txt @@ -0,0 +1,12 @@ +VERSION: 1.0 +@SECTION: String +0: +5: cp819 +31: shared_test_string_unique_14325 +31: shared_test_string_intern_12345 +7: test123 +8: cyrillic +@SECTION: Symbol +41 -1: (Ljava/util/Set;Ljava/lang/Object;)V +10 -1: linkMet%%%hod +20 -1: isAlphaNumericString diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidSymbolFormat.txt b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidSymbolFormat.txt new file mode 100644 index 00000000000..affa466d4e9 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidSymbolFormat.txt @@ -0,0 +1,11 @@ +VERSION: 1.0 +@SECTION: String +0: +5: cp819 +31: shared_test_string_unique_14325 +31: shared_test_string_intern_12345 +7: test123 +@SECTION: Symbol +41: (Ljava/util/Set;Ljava/lang/Object;)V +10 -1: linkMethod +20 -1: isAlphaNumericString diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidVersion.txt b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidVersion.txt new file mode 100644 index 00000000000..2d917344c6e --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidVersion.txt @@ -0,0 +1,60 @@ +VERSION: 0.0 +@SECTION: String +0: +5: cp819 +31: shared_test_string_unique_14325 +31: shared_test_string_intern_12345 +7: test123 +1: * +1: - +1: . +1: / +1: : +1: C +1: I +1: J +1: U +1: Z +1: _ +8: segments +1: | +5: cp850 +5: cp852 +5: cp855 +5: cp857 +5: cp858 +5: cp862 +5: cp866 +11: ISO_8859_13 +11: ISO_8859_15 +5: cp874 +47: java.lang.invoke.MethodHandle.TRACE_INTERPRETER +7: CHECKED +3: zip +10: waitStatus +33: java.lang.invoke.MethodHandleImpl +7: .jimage +5: cp912 +5: cp914 +5: cp915 +5: cp920 +5: cp923 +5: cp936 +5: euccn +5: eucjp +11: permissions +5: euckr +6: SIGNAL +5: cp737 +17: java.library.path +5: cp775 +13: classValueMap +4: utf8 +9: PROPAGATE +9: baseCount +7: cskoi8r +8: cyrillic +#DATATYPE: Symbol +41 -1: (Ljava/util/Set;Ljava/lang/Object;)V +10 -1: linkMethod +20 -1: isAlphaNumericString diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/OverflowPrefix.txt b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/OverflowPrefix.txt new file mode 100644 index 00000000000..8da872dca23 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/OverflowPrefix.txt @@ -0,0 +1,11 @@ +VERSION: 1.0 +@SECTION: String +0: +2147483648: cp819 +31: shared_test_string_unique_14325 +31: shared_test_string_intern_12345 +7: test123 +@SECTION: Symbol +41 -1: (Ljava/util/Set;Ljava/lang/Object;)V +10 -1: linkMethod +20 -1: isAlphaNumericString diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/TruncatedString.txt b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/TruncatedString.txt new file mode 100644 index 00000000000..849f8b5ddfd --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/TruncatedString.txt @@ -0,0 +1,10 @@ +VERSION: 1.0 +@SECTION: String +2147483647: s +5: cp819 +31: shared_test_string_intern_12345 +7: test123 +@SECTION: Symbol +41 -1: (Ljava/util/Set;Ljava/lang/Object;)V +10 -1: linkMethod +20 -1: isAlphaNumericString diff --git a/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/UnrecognizedPrefix.txt b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/UnrecognizedPrefix.txt new file mode 100644 index 00000000000..e979c3d8910 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/UnrecognizedPrefix.txt @@ -0,0 +1,11 @@ +VERSION: 1.0 +@SECTION: String +0: +5: cp819 +3E: shared_test_string_unique_14325 +31: shared_test_string_intern_12345 +7: test123 +@SECTION: Symbol +41 -1: (Ljava/util/Set;Ljava/lang/Object;)V +10 -1: linkMethod +20 -1: isAlphaNumericString diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/ArrayListTest.java b/test/hotspot/jtreg/runtime/appcds/test-classes/ArrayListTest.java new file mode 100644 index 00000000000..d6ac26e960a --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/ArrayListTest.java @@ -0,0 +1,41 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.util.*; + +// This is a test case executed by DumpClassList.java to load classes +// from various places to ensure that they are not written to the class list. +public class ArrayListTest { + public static void main(String args[]) throws Exception { + // The following lambda usage should generate various classes like + // java.lang.invoke.LambdaForm$MH/1146743572. All of them should be excluded from + // the class list. + List a = new ArrayList<>(); + a.add("hello world."); + a.forEach(str -> System.out.println(str)); + + System.out.println(Class.forName("java.lang.NewClass")); // should be excluded from the class list. + System.out.println(Class.forName("boot.append.Foo")); // should be excluded from the class list. + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/BootClassPathAppendHelper.java b/test/hotspot/jtreg/runtime/appcds/test-classes/BootClassPathAppendHelper.java new file mode 100644 index 00000000000..79cd2805ee3 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/BootClassPathAppendHelper.java @@ -0,0 +1,42 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +public class BootClassPathAppendHelper { + public static void main(String[] args) throws ClassNotFoundException { + Class cls = Class.forName("Hello"); + + if (cls == null) { + throw new java.lang.RuntimeException("Cannot find Hello.class"); + } + + WhiteBox wb = WhiteBox.getWhiteBox(); + if (!wb.isSharedClass(cls)) { + System.out.println("Hello.class is not in shared space as expected."); + } else { + throw new java.lang.RuntimeException("Hello.class shouldn't be in shared space."); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/C1.java b/test/hotspot/jtreg/runtime/appcds/test-classes/C1.java new file mode 100644 index 00000000000..86201cd4e34 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/C1.java @@ -0,0 +1,28 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +package sealed.pkg; + +public class C1 { +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/C2.java b/test/hotspot/jtreg/runtime/appcds/test-classes/C2.java new file mode 100644 index 00000000000..ad0026fbc53 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/C2.java @@ -0,0 +1,28 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +package pkg; + +public class C2 { +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/CheckIfShared.java b/test/hotspot/jtreg/runtime/appcds/test-classes/CheckIfShared.java new file mode 100644 index 00000000000..6e919ad5bce --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/CheckIfShared.java @@ -0,0 +1,40 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +public class CheckIfShared { + public static void main(String args[]) throws Exception { + WhiteBox wb = WhiteBox.getWhiteBox(); + if ("true".equals(args[0])) { + if (!wb.isSharedClass(CheckIfShared.class)) { + throw new RuntimeException("wb.isSharedClass(CheckIfShared.class) should be true"); + } + } else { + if (wb.isSharedClass(CheckIfShared.class)) { + throw new RuntimeException("wb.isSharedClass(CheckIfShared.class) should be false"); + } + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/Child.java b/test/hotspot/jtreg/runtime/appcds/test-classes/Child.java new file mode 100644 index 00000000000..8a3684e15a6 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/Child.java @@ -0,0 +1,25 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class Child extends Super {} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr1.java b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr1.java new file mode 100644 index 00000000000..5006870cd6d --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr1.java @@ -0,0 +1,38 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class CpAttr1 { + public static void main(String args[]) { + System.out.println("2"); CpAttr2.doit(); // Only the version of this class defined in CpAttr2.java will not throw exception. + System.out.println("3"); CpAttr3.doit(); // Only the version of this class defined in CpAttr3.java will not throw exception. + System.out.println("4"); CpAttr4.doit(); // Only the version of this class defined in CpAttr4.java will not throw exception. + System.out.println("5"); CpAttr5.doit(); // Only the version of this class defined in CpAttr5.java will not throw exception. + System.out.println("Test passed"); + } +} + +class CpAttr2 { static void doit() {throw new RuntimeException("");} } +class CpAttr3 { static void doit() {throw new RuntimeException("");} } +class CpAttr4 { static void doit() {throw new RuntimeException("");} } +class CpAttr5 { static void doit() {throw new RuntimeException("");} } diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr2.java b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr2.java new file mode 100644 index 00000000000..4777e1caf9e --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr2.java @@ -0,0 +1,25 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +class CpAttr2 { static void doit() {} } diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr3.java b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr3.java new file mode 100644 index 00000000000..96b19d0424c --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr3.java @@ -0,0 +1,26 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +class CpAttr2 { static void doit() {throw new RuntimeException("");} } +class CpAttr3 { static void doit() {} } diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr4.java b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr4.java new file mode 100644 index 00000000000..9711148f877 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr4.java @@ -0,0 +1,28 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +class CpAttr2 { static void doit() {throw new RuntimeException("");} } +class CpAttr3 { static void doit() {throw new RuntimeException("");} } +class CpAttr4 { static void doit() {} } +class CpAttr5 { static void doit() {throw new RuntimeException("");} } diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr5.java b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr5.java new file mode 100644 index 00000000000..94812653c48 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr5.java @@ -0,0 +1,25 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +class CpAttr5 { static void doit() {} } diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/DummyClassHelper.java b/test/hotspot/jtreg/runtime/appcds/test-classes/DummyClassHelper.java new file mode 100644 index 00000000000..56ffa75bd29 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/DummyClassHelper.java @@ -0,0 +1,58 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.lang.*; +import java.lang.reflect.*; +import sun.hotspot.WhiteBox; + +public class DummyClassHelper { + public static void main(String[] args) throws Exception { + String[] classNames = {args[0], args[1]}; + Class cls = null; + if (args.length == 2) { + for (int i = 0; i < classNames.length; i++) { + Method m = null; + cls = Class.forName(classNames[i]); + try { + m = cls.getMethod("thisClassIsDummy"); + throw new java.lang.RuntimeException(classNames[i] + + " should be loaded from the jimage and should not have the thisClassIsDummy() method."); + } catch(NoSuchMethodException ex) { + System.out.println(ex.toString()); + } + } + } else { + WhiteBox wb = WhiteBox.getWhiteBox(); + for (int i = 0; i < classNames.length; i++) { + cls = Class.forName(classNames[i]); + if (!wb.isSharedClass(cls)) { + System.out.println(classNames[i] + ".class" + " is not in shared space as expected."); + } else { + throw new java.lang.RuntimeException(classNames[i] + + ".class shouldn't be in shared space."); + } + } + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/EmptyClassHelper.java b/test/hotspot/jtreg/runtime/appcds/test-classes/EmptyClassHelper.java new file mode 100644 index 00000000000..86805214617 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/EmptyClassHelper.java @@ -0,0 +1,59 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.lang.*; +import java.lang.reflect.*; +import jdk.internal.misc.JavaLangAccess; +import jdk.internal.misc.SharedSecrets; + +class EmptyClassHelper { + static final JavaLangAccess jla = SharedSecrets.getJavaLangAccess(); + static final String USE_APP = "useAppLoader"; + public static void main(String[] args) throws Exception { + Class cls = null; + Method m = null; + ClassLoader appLoader = ClassLoader.getSystemClassLoader(); + String className = "com.sun.tools.javac.Main"; + if (args[0].equals(USE_APP)) { + cls = appLoader.loadClass(className); + System.out.println("appLoader loaded class"); + try { + m = cls.getMethod("main", String[].class); + System.out.println("appLoader found method main"); + } catch(NoSuchMethodException ex) { + System.out.println(ex.toString()); + } + } else { + cls = jla.findBootstrapClassOrNull(appLoader, className); + System.out.println("bootLoader loaded class"); + System.out.println("cls = " + cls); + try { + m = cls.getMethod("main", String[].class); + System.out.println("bootLoader found method main"); + } catch(NoSuchMethodException ex) { + System.out.println(ex.toString()); + } + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/FieldAnnotationsApp.java b/test/hotspot/jtreg/runtime/appcds/test-classes/FieldAnnotationsApp.java new file mode 100644 index 00000000000..70808d8af64 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/FieldAnnotationsApp.java @@ -0,0 +1,58 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.lang.annotation.Annotation; +import java.lang.reflect.Field; + +public class FieldAnnotationsApp { + @MyAnnotation(name="myField1", value="myValue1") + public String myField1 = null; + + @MyAnnotation(name="myField2", value="myValue2") + public String myField2 = null; + + public static void main(String args[]) throws Exception { + for (int i=1; i<=2; i++) { + Field field = FieldAnnotationsApp.class.getField("myField" + i); + Annotation[] annotations = field.getDeclaredAnnotations(); + + for (Annotation anno : annotations){ + if (anno instanceof MyAnnotation){ + MyAnnotation myAnno = (MyAnnotation) anno; + String name = myAnno.name(); + String value = myAnno.value(); + + System.out.println("Field : " + field.getName()); + System.out.println(" myAnno.name : " + name); + System.out.println(" myAnno.value: " + value); + + if (!(name.equals("myField" + i) && value.equals("myValue" + i))) { + throw new Exception("Unexpected annotation values: " + i + " = " + value); + } + } + } + } + System.out.println("Field annotations are OK."); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/ForNameTest.java b/test/hotspot/jtreg/runtime/appcds/test-classes/ForNameTest.java new file mode 100644 index 00000000000..b313af1ccc7 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/ForNameTest.java @@ -0,0 +1,45 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +public class ForNameTest { + public static void main(String[] args) throws Throwable { + // Hello is on the bootclasspath. The defining classloader is + // the NULL classloader. See AppCDSClassLoaderTest. + Class c = Class.forName("Hello"); + ClassLoader cl = c.getClassLoader(); + if (cl != null) { + throw new RuntimeException( + "Test Failed. Wrong classloader is used. Expect the NULL classloader."); + } + + WhiteBox wb = WhiteBox.getWhiteBox(); + if (!wb.isSharedClass(c)) { + System.out.println("As expected, Hello.class is not in shared space."); + } else { + throw new java.lang.RuntimeException("Hello.class shouldn't be in shared space."); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/Greet.java b/test/hotspot/jtreg/runtime/appcds/test-classes/Greet.java new file mode 100644 index 00000000000..174e97ac205 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/Greet.java @@ -0,0 +1,30 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class Greet { + + public String Greeting() { + return new String(", how are you?"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/Hello.java b/test/hotspot/jtreg/runtime/appcds/test-classes/Hello.java new file mode 100644 index 00000000000..dc134771ba5 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/Hello.java @@ -0,0 +1,29 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class Hello { + public static void main(String args[]) { + System.out.println("Hello World"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/HelloExt.java b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloExt.java new file mode 100644 index 00000000000..bd11763271a --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloExt.java @@ -0,0 +1,59 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +public class HelloExt { + public static void main(String[] args) throws Throwable { + + String className = "org.omg.CORBA.ORB"; + Class cls = Class.forName(className); + + ClassLoader loader = cls.getClassLoader(); + if (loader != ClassLoader.getPlatformClassLoader()) { + throw new java.lang.RuntimeException(className + " should be load by PlatformClassLoader but it is loaded by " + loader); + } + + WhiteBox wb = WhiteBox.getWhiteBox(); + if (wb.isSharedClass(cls)) { + System.out.println("As expected, " + className + " is in shared space."); + } else { + throw new java.lang.RuntimeException(className + " is not in shared space."); + } + + className = "[Ljava.lang.Comparable;"; + cls = Class.forName(className); + loader = cls.getClassLoader(); + if (loader != null) { + throw new java.lang.RuntimeException(className + " should be load by the NULL class loader but it is loaded by " + loader); + } + + if (wb.isSharedClass(cls)) { + System.out.println("As expected, " + className + " is in shared space."); + } else { + throw new java.lang.RuntimeException(className + " is not in shared space."); + } + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/HelloExtApp.java b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloExtApp.java new file mode 100644 index 00000000000..a4dd73f390b --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloExtApp.java @@ -0,0 +1,29 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class HelloExtApp { + public static void main(String args[]) { + System.out.println("Hello World Ext: " + HelloExtExt.class.getProtectionDomain()); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/HelloExtExt.java b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloExtExt.java new file mode 100644 index 00000000000..d74901c782a --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloExtExt.java @@ -0,0 +1,27 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class HelloExtExt { + +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/HelloMore.java b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloMore.java new file mode 100644 index 00000000000..dee1b239177 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloMore.java @@ -0,0 +1,30 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class HelloMore { + public static void main(String args[]) { + Hello.main(args); + System.out.println("Hello World ... More"); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/HelloWB.java b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloWB.java new file mode 100644 index 00000000000..92c0d9e02fa --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloWB.java @@ -0,0 +1,37 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +public class HelloWB { + public static void main(String[] args) throws Throwable { + + WhiteBox wb = WhiteBox.getWhiteBox(); + if (wb.isSharedClass(HelloWB.class)) { + System.out.println("As expected, HelloWB.class is in shared space."); + } else { + throw new java.lang.RuntimeException("HelloWB.class should be in shared space."); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/Hi.java b/test/hotspot/jtreg/runtime/appcds/test-classes/Hi.java new file mode 100644 index 00000000000..8250c323a8b --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/Hi.java @@ -0,0 +1,35 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class Hi extends Greet { + public static void main(String args[]) { + Greet g = new Greet(); + MyClass.doit(g.Greeting()); + } + public static class MyClass { + public static void doit(String greeting) { + System.out.println("Hi" + greeting); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/Iloadw.jasm b/test/hotspot/jtreg/runtime/appcds/test-classes/Iloadw.jasm new file mode 100644 index 00000000000..90d31f9fbf6 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/Iloadw.jasm @@ -0,0 +1,37 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class Iloadw + version 51: 0 +{ + public static Method run:"()I" + stack 1 locals 400 + { + iconst_0; + istore_w 300; + iinc_w 300,1; + iload_w 300; + ireturn; + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/IloadwMain.java b/test/hotspot/jtreg/runtime/appcds/test-classes/IloadwMain.java new file mode 100644 index 00000000000..315e00a2b38 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/IloadwMain.java @@ -0,0 +1,35 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class IloadwMain { + public static void main(String args[]) { + int result = Iloadw.run(); + if (result != 1) { + throw new RuntimeException( + "Failed. Result is " + result + ", expect 1."); + } else { + System.out.println("Passed."); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/JimageClassPackage.java b/test/hotspot/jtreg/runtime/appcds/test-classes/JimageClassPackage.java new file mode 100644 index 00000000000..f9358a1e28f --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/JimageClassPackage.java @@ -0,0 +1,95 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class JimageClassPackage { + public static void main(String args[]) throws Throwable { + // Test Package for boot/app/ext module classes from the "modules" jimage. + // The following classes are archived. See runtime/AppCDS/Package.java. + // java.util.Dictionary (testcase 0), + // sun.tools.javac.Main (testcase 1), + // jdk.nio.zipfs.ZipInfo (testcase 2), + // java.net.URL (testcase 3), + // sun.rmi.rmic.Main (testcase 4), + // com.sun.jndi.dns.DnsName (testcase 5) + String testcases[][] = + {{"Loading shared boot module class first", "java.util", + "java.util.Dictionary", "java.util.ServiceConfigurationError"}, + + {"Loading shared app module class first", "sun.tools.javac", + "sun.tools.javac.Main", "sun.tools.javac.BatchParser"}, + + {"Loading shared ext module class first", "jdk.nio.zipfs", + "jdk.nio.zipfs.ZipInfo", "jdk.nio.zipfs.ZipPath"}, + + {"Loading non-shared boot module class first", "java.net", + "java.net.HttpCookie", "java.net.URL"}, + + {"Loading non-shared app module class first", "sun.rmi.rmic", + "sun.rmi.rmic.RMIGenerator", "sun.rmi.rmic.Main"}, + + {"Loading non-shared ext module class first", "com.sun.jndi.dns", + "com.sun.jndi.dns.Resolver", "com.sun.jndi.dns.DnsName"}}; + + JimageClassPackage test = new JimageClassPackage(); + for (int i = 0; i < testcases.length; i++) { + System.out.println("Testcase " + i + ": " + testcases[i][0]); + test.testPackage(testcases[i][1], testcases[i][2], testcases[i][3]); + } + } + + private void testPackage (String pkg, + String shared, + String nonShared) throws Throwable { + Class c1 = Class.forName(shared); + ClassLoader cl = c1.getClassLoader(); + Package pkg_from_loader; + if (cl != null) { + pkg_from_loader = cl.getDefinedPackage(pkg); + } else { + pkg_from_loader = Package.getPackage(pkg); + } + + Package pkg_from_shared_class = c1.getPackage(); + + Class c2 = Class.forName(nonShared); + Package pkg_from_nonshared_class = c2.getPackage(); + + if (pkg_from_loader != null && + pkg_from_shared_class != null && + pkg_from_loader == pkg_from_shared_class && + pkg_from_shared_class == pkg_from_nonshared_class && + pkg_from_shared_class.getName().equals(pkg)) { + System.out.println("Expected package: " + pkg_from_shared_class.toString()); + } else { + System.out.println("Unexpected package" + pkg_from_shared_class); + System.exit(1); + } + if (pkg_from_shared_class.isSealed()) { + System.out.println("Package is sealed"); + } else { + System.out.println("Package is not sealed"); + System.exit(1); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/JimageClassProtDomain.java b/test/hotspot/jtreg/runtime/appcds/test-classes/JimageClassProtDomain.java new file mode 100644 index 00000000000..e47aaaa8a36 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/JimageClassProtDomain.java @@ -0,0 +1,74 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class JimageClassProtDomain { + public static void main(String args[]) throws Throwable { + // Test ProtectionDomain for boot/app/ext module classes from the "modules" jimage. + // The following classes are archived. See runtime/AppCDS/ProtectionDomain.java. + // java.util.Dictionary (testcase 0), + // sun.tools.javac.Main (testcase 1), + // jdk.nio.zipfs.ZipInfo (testcase 2), + // java.net.URL (testcase 3), + // sun.rmi.rmic.Main (testcase 4), + // com.sun.jndi.dns.DnsName (testcase 5) + String testcases[][] = + {{"Loading shared boot module class first", + "java.util.Dictionary", "java.util.ServiceConfigurationError"}, + + {"Loading shared app module class first", + "sun.tools.javac.Main", "sun.tools.javac.BatchParser"}, + + {"Loading shared ext module class first", + "jdk.nio.zipfs.ZipInfo", "jdk.nio.zipfs.ZipPath"}, + + {"Loading non-shared boot module class first", + "java.net.HttpCookie", "java.net.URL"}, + + {"Loading non-shared app module class first", + "sun.rmi.rmic.RMIGenerator", "sun.rmi.rmic.Main"}, + + {"Loading non-shared ext module class first", + "com.sun.jndi.dns.Resolver", "com.sun.jndi.dns.DnsName"}}; + for (int i = 0; i < testcases.length; i++) { + System.out.println("Testcase " + i + ": " + testcases[i][0]); + JimageClassProtDomain.testProtectionDomain(testcases[i][1], testcases[i][2]); + } + } + + private static void testProtectionDomain(String shared, String nonShared) + throws Throwable { + Class c1 = Class.forName(shared); + Class c2 = Class.forName(nonShared); + if (c1.getProtectionDomain() != c2.getProtectionDomain()) { + System.out.println("Failed: Protection Domains do not match!"); + System.out.println(c1.getProtectionDomain()); + System.out.println(c1.getProtectionDomain().getCodeSource()); + System.out.println(c2.getProtectionDomain()); + System.out.println(c2.getProtectionDomain().getCodeSource()); + System.exit(1); + } else { + System.out.println("Passed: Protection Domains match."); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/JvmtiApp.java b/test/hotspot/jtreg/runtime/appcds/test-classes/JvmtiApp.java new file mode 100644 index 00000000000..e0c0ea55fb6 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/JvmtiApp.java @@ -0,0 +1,105 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +public class JvmtiApp { + static Class forname() { + try { + return Class.forName("Hello"); + } catch (Throwable t) { + return null; + } + } + + static void failed(String msg) { + System.out.println("TEST FAILED: " + msg); + System.exit(1); + } + + // See ../JvmtiAddPath.java for how the classpaths are configured. + public static void main(String args[]) { + if (args[0].equals("noadd")) { + if (forname() != null) { + failed("Hello class was loaded unexpectedly"); + } + // We use -verbose:class to verify that Extra.class IS loaded by AppCDS if + // the boot classpath HAS NOT been appended. + ExtraClass.doit(); + System.exit(0); + } + + WhiteBox wb = WhiteBox.getWhiteBox(); + + if (args[0].equals("bootonly")) { + wb.addToBootstrapClassLoaderSearch(args[1]); + Class cls = forname(); + if (cls == null) { + failed("Cannot find Hello class"); + } + if (cls.getClassLoader() != null) { + failed("Hello class not loaded by boot classloader"); + } + } else if (args[0].equals("apponly")) { + wb.addToSystemClassLoaderSearch(args[1]); + Class cls = forname(); + if (cls == null) { + failed("Cannot find Hello class"); + } + if (cls.getClassLoader() != JvmtiApp.class.getClassLoader()) { + failed("Hello class not loaded by app classloader"); + } + } else if (args[0].equals("noadd-appcds")) { + Class cls = forname(); + if (cls == null) { + failed("Cannot find Hello class"); + } + if (cls.getClassLoader() != JvmtiApp.class.getClassLoader()) { + failed("Hello class not loaded by app classloader"); + } + } else if (args[0].equals("appandboot")) { + wb.addToBootstrapClassLoaderSearch(args[1]); + wb.addToSystemClassLoaderSearch(args[2]); + Class cls = forname(); + if (cls == null) { + failed("Cannot find Hello class"); + } + if (cls.getClassLoader() != null) { + failed("Hello class not loaded by boot classloader"); + } + } else { + failed("unknown option " + args[0]); + } + + // We use -verbose:class to verify that Extra.class IS NOT loaded by AppCDS if + // the boot classpath HAS been appended. + ExtraClass.doit(); + + System.out.println("Test passed: " + args[0]); + } +} + +class ExtraClass { + static void doit() {} +} \ No newline at end of file diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/MethodNoReturn.jasm b/test/hotspot/jtreg/runtime/appcds/test-classes/MethodNoReturn.jasm new file mode 100644 index 00000000000..c9c17a50473 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/MethodNoReturn.jasm @@ -0,0 +1,93 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +/* +WAS: + +class MethodNoReturn { + void badMethod() {} +} +*/ + +super class MethodNoReturn + version 52:0 +{ + + +Method "":"()V" + stack 1 locals 1 +{ + aload_0; + invokespecial Method java/lang/Object."":"()V"; + return; +} + +Method badMethod:"()V" + stack 0 locals 1 +{ + /* + should be: + return; + */ + + iconst_1; + pop; + iconst_1; + pop; + iconst_1; + pop; + iconst_1; + pop; + iconst_1; + pop; + iconst_1; + pop; + iconst_1; + pop; + iconst_1; + pop; + iconst_1; + pop; + iconst_1; + pop; + iconst_1; + iconst_1; + iconst_1; + iconst_1; + iconst_1; + iconst_1; + iconst_1; + iconst_1; + pop; + pop; + pop; + pop; + pop; + pop; + pop; + pop; + // no return here -- so this class will fail verification +} + +} // end Class MethodNoReturn diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/MissingSuper.java b/test/hotspot/jtreg/runtime/appcds/test-classes/MissingSuper.java new file mode 100644 index 00000000000..ef47a7cb9e4 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/MissingSuper.java @@ -0,0 +1,49 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class MissingSuper { + public static void main(String args[]) { + try { + new MissingSuperSub(); + } catch (NoClassDefFoundError e) { + System.out.println("Expected NoClassDefFoundError:"); + e.printStackTrace(System.out); + } + + try { + new MissingSuperImpl(); + } catch (NoClassDefFoundError e) { + System.out.println("Expected NoClassDefFoundError:"); + e.printStackTrace(System.out); + } + } +} + +class MissingSuperSup {} // This class will be deleted from missing_super.jar before dumping + +class MissingSuperSub extends MissingSuperSup {} + +interface MissingSuperIntf {} // This interface will be deleted from missing_super.jar before dumping + +class MissingSuperImpl implements MissingSuperIntf {} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/MultiProcClass.java b/test/hotspot/jtreg/runtime/appcds/test-classes/MultiProcClass.java new file mode 100644 index 00000000000..cf67318a24e --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/MultiProcClass.java @@ -0,0 +1,66 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import sun.hotspot.WhiteBox; + +// This class should be loaded from a shared archive. +public class MultiProcClass { + private static String instanceLabel; + + public static void main(String args[]) throws Exception { + instanceLabel = args[0]; + String checkPmap = args[1]; + + long pid = ProcessHandle.current().pid(); + System.out.println(inst("========================== Starting MultiProcClass")); + System.out.println(inst("My PID: " + pid )); + System.out.println(inst("checkPmap = <" + checkPmap + ">" )); + + if ("true".equals(checkPmap)) { + if (runPmap(pid, true) != 0) + System.out.println("MultiProcClass: Pmap failed"); + } + + WhiteBox wb = WhiteBox.getWhiteBox(); + if (!wb.isSharedClass(MultiProcClass.class)) { + throw new RuntimeException(inst("MultiProcClass should be shared but is not.")); + } + + System.out.println(inst("========================== Leaving MultiProcClass")); + } + + // A convenience method to append process instance label + private static String inst(String msg) { + return "process-" + instanceLabel + " : " + msg; + } + + // Use on Linux-only; requires jdk-9 for Process.pid() + public static int runPmap(long pid, boolean inheritIO) throws Exception { + ProcessBuilder pmapPb = new ProcessBuilder("pmap", "" + pid); + if (inheritIO) + pmapPb.inheritIO(); + + return pmapPb.start().waitFor(); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/MyAnnotation.java b/test/hotspot/jtreg/runtime/appcds/test-classes/MyAnnotation.java new file mode 100644 index 00000000000..cbec72aecf6 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/MyAnnotation.java @@ -0,0 +1,36 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.lang.annotation.Target; +import java.lang.annotation.ElementType; +import java.lang.annotation.Retention; +import java.lang.annotation.RetentionPolicy; + +@Retention(RetentionPolicy.RUNTIME) +@Target(ElementType.FIELD) + +public @interface MyAnnotation { + public String name(); + public String value(); +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/PackageSealingTest.java b/test/hotspot/jtreg/runtime/appcds/test-classes/PackageSealingTest.java new file mode 100644 index 00000000000..a1e8ea0a234 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/PackageSealingTest.java @@ -0,0 +1,52 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.lang.Package; + +public class PackageSealingTest { + public static void main(String args[]) { + try { + Class c1 = PackageSealingTest.class.forName("sealed.pkg.C1"); + Class c2 = PackageSealingTest.class.forName("pkg.C2"); + Package p1 = c1.getPackage(); + System.out.println("Package 1: " + p1.toString()); + Package p2 = c2.getPackage(); + System.out.println("Package 2: " + p2.toString()); + + if (!p1.isSealed()) { + System.out.println("Failed: sealed.pkg is not sealed."); + System.exit(0); + } + + if (p2.isSealed()) { + System.out.println("Failed: pkg is sealed."); + System.exit(0); + } + + System.out.println("OK"); + } catch (Exception e) { + System.out.println(e.getMessage()); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/PackageTest.java b/test/hotspot/jtreg/runtime/appcds/test-classes/PackageTest.java new file mode 100644 index 00000000000..f5f1f15014b --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/PackageTest.java @@ -0,0 +1,56 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +package p; + +public class PackageTest { + public static void main(String args[]) { + (new PackageTest()).test(); + } + + private void test() { + ClassLoader cl = PackageTest.class.getClassLoader(); + Package pkg_from_loader; + if (cl != null) { + pkg_from_loader = cl.getDefinedPackage("p"); + } else { + pkg_from_loader = Package.getPackage("p"); + } + + Package pkg = PackageTest.class.getPackage(); + if (pkg_from_loader != null && pkg == pkg_from_loader && + pkg.getName().equals("p")) { + System.out.println("Expected package: " + pkg); + } else { + System.out.println("Unexpected package: " + pkg); + System.exit(1); + } + if (pkg.isSealed()) { + System.out.println("Package is sealed"); + System.exit(1); + } else { + System.out.println("Package is not sealed"); + } + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/ParallelClasses.java b/test/hotspot/jtreg/runtime/appcds/test-classes/ParallelClasses.java new file mode 100644 index 00000000000..a4d0520f235 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/ParallelClasses.java @@ -0,0 +1,64 @@ +/* + * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +class ParallelClass0 {} +class ParallelClass1 {} +class ParallelClass2 {} +class ParallelClass3 {} +class ParallelClass4 {} +class ParallelClass5 {} +class ParallelClass6 {} +class ParallelClass7 {} +class ParallelClass8 {} +class ParallelClass9 {} +class ParallelClass10 {} +class ParallelClass11 {} +class ParallelClass12 {} +class ParallelClass13 {} +class ParallelClass14 {} +class ParallelClass15 {} +class ParallelClass16 {} +class ParallelClass17 {} +class ParallelClass18 {} +class ParallelClass19 {} +class ParallelClass20 {} +class ParallelClass21 {} +class ParallelClass22 {} +class ParallelClass23 {} +class ParallelClass24 {} +class ParallelClass25 {} +class ParallelClass26 {} +class ParallelClass27 {} +class ParallelClass28 {} +class ParallelClass29 {} +class ParallelClass30 {} +class ParallelClass31 {} +class ParallelClass32 {} +class ParallelClass33 {} +class ParallelClass34 {} +class ParallelClass35 {} +class ParallelClass36 {} +class ParallelClass37 {} +class ParallelClass38 {} +class ParallelClass39 {} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/ParallelLoad.java b/test/hotspot/jtreg/runtime/appcds/test-classes/ParallelLoad.java new file mode 100644 index 00000000000..d47c3343845 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/ParallelLoad.java @@ -0,0 +1,220 @@ +/* + * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.io.*; +import java.net.*; +import java.lang.reflect.Field; + + +// This test helper is parameterized by: +// - class transformation mode: property "appcds.parallel.transform.mode" +// - class loader test types +// +// In the case of transformMode == "cflh", the transformation is performed +// by AppCDS/jvmti/TransformerAgent.java. The classes to be transformed, such as +// ParallelClassTr0, are defined in ./jvmti/parallelLoad/ParallelClasses.java + +public class ParallelLoad { + public static int MAX_CLASSES = 40; + public static int NUM_THREADS = 4; + + public final static int SYSTEM_LOADER = 0; + public final static int SINGLE_CUSTOM_LOADER = 1; + public final static int MULTI_CUSTOM_LOADER = 2; + + public static final int FINGERPRINT_MODE = 1; + public static final int API_MODE = 2; + + public static int loaderType = SYSTEM_LOADER; + public static ClassLoader classLoaders[]; + public static int mode = FINGERPRINT_MODE; + + public static float timeoutFactor = + Float.parseFloat(System.getProperty("test.timeout.factor", "1.0")); + + public static void main(String args[]) throws Throwable { + run(args, null); + } + public static void run(String args[], ClassLoader loaders[]) throws Throwable { + String customJar = null; + System.out.println("ParallelLoad: timeoutFactor = " + timeoutFactor); + + if (args.length >= 1) { + if ("SINGLE_CUSTOM_LOADER".equals(args[0])) { + loaderType = SINGLE_CUSTOM_LOADER; + customJar = args[2]; + } else if ("MULTI_CUSTOM_LOADER".equals(args[0])) { + loaderType = MULTI_CUSTOM_LOADER; + customJar = args[2]; + } else if ("SYSTEM_LOADER".equals(args[0])) { + loaderType = SYSTEM_LOADER; + } else { + throw new RuntimeException("Unexpected loaderType" + args[0]); + } + } + + if (customJar != null) { + if ("FINGERPRINT_MODE".equals(args[1])) { + mode = FINGERPRINT_MODE; + classLoaders = new ClassLoader[NUM_THREADS]; + for (int i=0; i loadClass(String name, boolean resolve) + throws ClassNotFoundException + { + called = true; + System.out.println("TestClassLoader: loadClass(\"" + name + "\", " + resolve + ")"); + return (super.loadClass(name, resolve)); + } +} diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/TrySwitchMyLoader.java b/test/hotspot/jtreg/runtime/appcds/test-classes/TrySwitchMyLoader.java new file mode 100644 index 00000000000..48a455debd0 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/TrySwitchMyLoader.java @@ -0,0 +1,36 @@ +/* + * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +public class TrySwitchMyLoader { + public static void main(String args[]) { + System.out.println("TrySwitchMyLoader's loader = " + ReportMyLoader.class.getClassLoader()); + System.setProperty("java.system.class.loader", "TestClassLoader"); + + // This should still report the same loader as TrySwitchMyLoader.class.getClassLoader(), + // as setting the java.system.class.loader after main method has been executed + // has no effect. + ReportMyLoader.main(args); + } +} + diff --git a/test/hotspot/jtreg/runtime/appcds/test-classes/Util.java b/test/hotspot/jtreg/runtime/appcds/test-classes/Util.java new file mode 100644 index 00000000000..4289c765257 --- /dev/null +++ b/test/hotspot/jtreg/runtime/appcds/test-classes/Util.java @@ -0,0 +1,156 @@ +/* + * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved. + * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER. + * + * This code is free software; you can redistribute it and/or modify it + * under the terms of the GNU General Public License version 2 only, as + * published by the Free Software Foundation. + * + * This code is distributed in the hope that it will be useful, but WITHOUT + * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or + * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License + * version 2 for more details (a copy is included in the LICENSE file that + * accompanied this code). + * + * You should have received a copy of the GNU General Public License version + * 2 along with this work; if not, write to the Free Software Foundation, + * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA. + * + * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA + * or visit www.oracle.com if you need additional information or have any + * questions. + * + */ + +import java.io.*; +import java.lang.reflect.*; +import java.util.jar.*; + +public class Util { + /** + * Invoke the loader.defineClass() class method to define the class stored in clsFile, + * with the following modification: + *
    + *
  • All ASCII strings in the class file bytes that matches fromString will be replaced with toString. + * NOTE: the two strings must be the exact same length. + *
+ */ + public static Class defineModifiedClass(ClassLoader loader, File clsFile, String fromString, String toString) + throws FileNotFoundException, IOException, NoSuchMethodException, IllegalAccessException, + InvocationTargetException + { + DataInputStream dis = new DataInputStream(new FileInputStream(clsFile)); + byte[] buff = new byte[(int)clsFile.length()]; + dis.readFully(buff); + replace(buff, fromString, toString); + + System.out.println("Loading from: " + clsFile + " (" + buff.length + " bytes)"); + + Method defineClass = ClassLoader.class.getDeclaredMethod("defineClass", + buff.getClass(), int.class, int.class); + defineClass.setAccessible(true); + + // We directly call into ClassLoader.defineClass() to define the "Super" class. Also, + // rewrite its classfile so that it returns ___yyy___ instead of ___xxx___. Changing the + // classfile will guarantee that this class will NOT be loaded from the CDS archive. + Class cls = (Class)defineClass.invoke(loader, buff, new Integer(0), new Integer(buff.length)); + System.out.println("Loaded : " + cls); + + return cls; + } + + /** + * @return the number of occurrences of the from string that + * have been replaced. + */ + public static int replace(byte buff[], String from, String to) { + if (to.length() != from.length()) { + throw new RuntimeException("bad strings"); + } + byte f[] = asciibytes(from); + byte t[] = asciibytes(to); + byte f0 = f[0]; + + int numReplaced = 0; + int max = buff.length - f.length; + for (int i=0; i